CAZyme Information: PSURA_74392T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_74392T0-p1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	PramPr-102_SC0007|CGC3	37004.23	4.1313

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0007:738795-739826(+)

Full Sequence      

MQAFVLPLAALAGLAISSAAGVETCSGPNARIEPPLGAIVVDASGDYDGSFLTVSEGVEN
LAITTKEQTIFVLPGVYKEQVLIPKLAGPLVLQGSTCDTMTYADNEVTIVQATAQKDLPK
ELTKGRNDMTSTLRFKSSNVKVYNLNIANTAGNVGQAVAATIDGTDYGFYACNFTGYQDT
LYANKGRELFAQSYISGAVDFVFGSKATAWFESCDIETVGKGCITANGRSDELNPSYFVF
NNARVFGSNAVGSSCLGRPWRPFARVAWQNSELSDVINPQGWSAWDSTSSTDDVHFREFN
NTGLGAATDERVEFSLELQKAVPITDILGEDFETEWWVDTDFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	319	1.8e-74	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	5.23e-48	39	318	34	306	probable pectinesterase
395871	Pectinesterase	7.24e-47	39	312	2	272	Pectinesterase.
215367	PLN02682	2.31e-44	35	327	67	358	pectinesterase family protein
178051	PLN02432	6.51e-43	39	323	13	279	putative pectinesterase
215117	PLN02176	7.99e-41	39	329	41	320	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54873.1|CE8	1.13e-164	1	343	1	344
ABQ63096.1|CE8	4.57e-164	1	343	1	344
ACO54869.1|CE8	1.06e-158	1	343	1	338
ACO54868.1|CE8	5.65e-155	1	343	1	343
AFM08806.1|CE8	2.99e-151	4	343	3	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.07e-62	31	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.51e-62	31	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	7.12e-35	39	312	11	279	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	9.89e-28	39	325	7	293	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.03e-11	70	330	63	360	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	5.68e-79	31	343	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.28e-77	31	342	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B8NPS7|PMEA_ASPFN	5.23e-66	1	342	1	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	2.93e-65	1	342	1	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.31e-64	11	342	10	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999750	CS pos: 19-20. Pr: 0.9638

TMHMM  Annotations     

There is no transmembrane helices in PSURA_74392T0-p1.