CAZyme Information: PSURA_74265T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_74265T0-p1
• CAZy Family: PL4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		31722.52	5.5481

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0007:119690-120556(+)

Full Sequence      

MLSSLYLTAFTIAVTFSTSVVDARQLSTGICYAPWHHPTINWGVLAQDMVQVSQHFSSIR
TYESQYNGVNVVDMAAAANLHVAVGVQLQNPQQIDAQIQAVCDGYARNAWAVEAVYVGNE
DLQNGGFGTYSAEQIAGYIRRVKSCVGNTPVGSVQRINEWLSASGAWTLANACDVIGVNI
YPFFTPGSQSSLKKLEAQWDQMVSKFGSNKLRLTETGFPYAGETYAGNVPSIGAMTQYFW
DYVYGFSGGKGQSYWFMMYDQSVSYSGKEYEKHFGLFGTDKSQHIDLP

Enzyme Prediction     

No EC number prediction in PSURA_74265T0-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.11e-18	46	281	66	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	4.90e-182	1	288	1	288
UIZ21797.1|GH17	4.51e-99	20	288	565	834
UIZ21931.1|GH17	2.69e-82	1	288	1	288
UIZ21795.1|GH17	4.21e-60	1	201	1	202
CCA18992.1|GH17	1.16e-39	29	288	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.63e-07	40	282	40	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.69e-06	40	282	40	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	1.48e-12	112	264	120	287	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|A1DBG6|BTGE_NEOFI	1.30e-11	53	237	324	508	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q04951|SCW10_YEAST	3.99e-07	29	231	138	342	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	2.27e-06	29	231	135	339	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999716	CS pos: 23-24. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in PSURA_74265T0-p1.