CAZyme Information: PSURA_74264T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_74264T0-p1
• CAZy Family: GH10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	PramPr-102_SC0007|CGC4	31531.15	5.2606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0007:117570-118436(-)

Full Sequence      

MAFSQYVTAFAVASAIATGATDATKLSSGVCYAPWHHQTVNWDVLAADMAQVSEHFSSIR
TYQVQFSGVNAIDMAAAAGLRIAVGVQLTDPRWIDSEIQAVCDGYKRNGGAVEAVYVGNE
DLKNGNFGTYTADQLAGYIRRVKSCVGNTPVGSAQRINEWLSADSAWTLANACDLIGVNI
HPFFTPGSQSSVKKLEAQWNEMTSKFGSDKVRLTETGWPYAGETYAGNVPSTGAMTQYFY
DYVYGWCPGKTQSYWFMMYDTTVSYNGADYEKHFGLFGTDKSQHINMP

Enzyme Prediction     

No EC number prediction in PSURA_74264T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	29	284	3.7e-16	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.12e-23	2	281	23	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.003	203	283	219	303	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	1.71e-159	1	288	1	288
UIZ21797.1|GH17	6.76e-97	22	288	567	834
UIZ21931.1|GH17	5.52e-87	1	288	1	288
UIZ21795.1|GH17	8.10e-63	1	201	1	202
CCA18992.1|GH17	2.27e-39	24	288	17	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.26e-09	29	282	39	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.35e-08	29	282	39	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WC60|BTGE_ASPFU	8.60e-14	44	232	328	518	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	8.60e-14	44	232	328	518	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	1.23e-12	53	237	324	508	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	3.60e-12	51	264	52	287	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q04951|SCW10_YEAST	5.92e-11	27	231	136	342	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.128733	0.871250	CS pos: 19-20. Pr: 0.6984

TMHMM  Annotations     

There is no transmembrane helices in PSURA_74264T0-p1.