CAZyme Information: PSURA_74256T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_74256T0-p1
• CAZy Family: GH10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	PramPr-102_SC0007|CGC3	46595.92	3.8813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0007:82163-83527(-)

Full Sequence      

MVFSSSARVAVVMAAVAIGADAGALTTGVCYAPWHHSTVDDSVVGQDMAQIGQYFSSVRT
FQAQFSGVNVIKAAAAAGIKVAVGVQLTDASAIDSEIEAVCAGYEANPDAVEAVYVGNEN
LKNGDFGTYSADELAAYITQVKACVGDTPVGSVQRINEWLSADGAATLSAASDVIGVNIY
PFFTESDQTAIEKLEAQWGQMTAKYDSSKLHVTETGWPSSGENYGSNVPSTDNMQQFLDD
YVTWSTGVGTSYWFMMYDTTISFSGAEYEKHFGLFTSGGVQKVTIPGGDAVSTTQQTNST
SSSSTGSTSQETTGAPTATETLVTEAPVVTETPAITETSATTAPVVTEAPAATVTTFTEG
STSSSSTGSTSQQTTGASASTETPVTEAPVSTEALATTETPATTAPVVIEASTTAPSTTD
TEGSTQSEATPVTTAATPTVTPVPAVKRCRAASK

Enzyme Prediction     

No EC number prediction in PSURA_74256T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	282	1.2e-22	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.87e-18	4	277	23	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.33e-05	166	282	191	304	Glycosyl hydrolases family 17.
236766	rne	0.006	318	419	914	1022	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	4.91e-114	16	286	17	288
UIZ21797.1|GH17	3.16e-111	20	289	566	837
UIZ21931.1|GH17	7.14e-75	1	286	1	288
UIZ21795.1|GH17	4.40e-51	1	200	1	202
CCA18992.1|GH17	1.18e-45	28	286	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.06e-08	38	240	51	249	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.04e-08	38	240	51	249	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	5.03e-13	93	260	98	285	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|A2QH21|EGLC_ASPNC	3.57e-11	111	260	120	285	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q04951|SCW10_YEAST	8.79e-11	28	277	138	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	1.16e-10	28	277	135	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1DJ47|EGLC_NEOFI	3.38e-10	111	258	120	283	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.285423	0.714568	CS pos: 22-23. Pr: 0.5671

TMHMM  Annotations     

There is no transmembrane helices in PSURA_74256T0-p1.