CAZyme Information: PSURA_73630T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_73630T0-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	PramPr-102_SC0004|CGC1	67880.43	6.4564

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0004:397304-399139(-)

Full Sequence      

MAPPSVHTRHGKRLAVTRTPPPSPRNAPRVGILALFSVIGLYAVGFVVWGVCLGDVASSS
DSANGGDVRLSPLLMRQLRRHQRVEAAGSNDNLSMGKRWTEQLLDTGSRPPDLRCIGWKQ
TESCDLQSTQTPTKNRGCDQFVRGGVAGYCLMQDEATGQQLQVMHTSCDTLHPSVMLSCR
HAGDFVDFQWEVAKLAAEVEREESAAEDKEVTDATPTEGIVMVIYPKLLVSAFASIRALR
AVNCTLPVELWYIESEMDSKDGVSLLGGIPKRLQQEYGPLTLHPIADPRVAGFNSKVYAI
THTTFEHVMFLDADNVPVKDPSYLFKTPEFVQMGAVFWPDFWHPAHTIFNINDESLLWEL
LGMDYVDMFEQESGQLVIDKSRSAAALRMLSLFAFHDPNLFSRYKLAHGDKDLFRLAWLK
TKTPFHMVANPPGIAGTVREAKFCGMSMAQFDMDGDVLFLHRNAKKLSGGLGANRKPDEL
IWTHLQRFRYRAASPHAAEVEAAFEASKPTLPPNAKIGSPRVPVGNLNMSYSLLRQKYSV
EIFNGAPEFEETQWCYGQAALTAPRYKTIAWQDTAFSNVERDLLQYASEAVAMLPAAAVE
LIVQSDRQEAS

Enzyme Prediction     

No EC number prediction in PSURA_73630T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	218	452	5.3e-52	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.99e-44	219	452	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.002	283	350	68	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24000.1|GT71	9.27e-95	37	605	32	574
UIZ28362.1|GT71	2.96e-92	103	488	656	1040
UIZ28119.1|GT71	6.28e-89	222	591	1	355
UIZ29182.1|GT71	7.15e-88	112	486	65	419
UIZ24059.1|GT71	1.79e-87	41	489	647	1112

PDB Hits     

PSURA_73630T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	7.13e-15	219	460	247	534	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	1.83e-13	219	452	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AP90|MNN23_CANAL	4.30e-13	217	450	173	447	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|P46982|MNN5_YEAST	1.27e-12	217	478	149	459	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	2.22e-12	217	456	149	437	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999951	0.000074

TMHMM  Annotations     

Start	End
31	53