CAZyme Information: PSURA_73619T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_73619T0-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1769	PramPr-102_SC0004|CGC3	199767.54	7.2239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0004:366525-372789(+)

Full Sequence      

MASSAPRRHGLLHLLLLGSLLYALAVLSYSLFSVHSTSLLPSVRLSGVFESVQTTFGHVR
RTAEQQQADNHAFQVGLLPSGETMERHFKCIGWRATGGCRPSGPRLPALDRPCTKTIPHG
QSGYCELQDEDSGELFRVARRTCADVVGKAALFRCLEAPRFANFHALAREAAQRALDPGF
ALPNAGSSDHVPKDGIVMVVYPKMVPSAYATIRVLREVLRCRLPIEIWFRPDEMRKVTAS
IDPLHQIAANDSIGGISFREIDDPLAVEFATKVFAVYNSAFARVLFLDSDNVPVRDPTFL
FQTPEFVTTGAVFWPDFWHPQHTLFYLGEDSLLWELLDMPFVDMFEQESGQLLIDRRRHA
APIELVRFFAFHRPNPFAQLKLVWGDKDLFRLAWLKLEVPFHMIQSPPAVAGKVNGSSFC
GMTMVQHDGDGHVLFLHRNSHKLTGGRSRNPADQKLKAIRENEAPVDNGPDGLPDAAIWT
HLLSFRSSSPRSKYQIETYHAEPEFSKDQVCYGQRRLGENDNFYAQEFAVLSFSGLEMHL
RRFAMEAGQLHQAKVDAIAEAQQLQRKPEHGRSSCRLARMQPAKADHTSMEAARCSRRWG
PRFLRTLLLGSVLYAVLVLCWSARNVHLSGSRGESPSMDFAAVLERVHRPMANALQQVKD
TVEEIQRTPSPQELEAEEHARSVPDLPSGELQWRNLTCIGWRATSDCKPDGPRDLAKDLP
CDQAVEVGSSGYCEVQDVHSGELFRVMRRTCASNKKSQVFRCSDAQQFVNYHIEALDAVK
AALEPGFALPNVAGKEHGRDGIVMVVYPKMVASAYATIRTLRDVLGCRLPIEIWFRQDEI
DRVPRSLLPLQQLAGNDTLRAIIFREINDSRAVSFGAKVFALYNSGFDRILFLDADNVPV
RDPAYLFKSAEFERTGAVFWPDYWHPHYTIFHLHGDSLLWELLSIPYVDMFEQESGQLLI
DRRRHAAPLELVRFFTFHQPNPIEQLKLLWGDKDLFRFAWIKLDVPFFMVQTPPAVAGNV
NGTSFCGMTMVQHDAQGEVLFLHRNAKKLTGEVLYKPVNYHIQARRRIRSRWIKQGIYRV
PSEEEVVEELKMLKKTMPPPLEPPEPDGIADQAVWTHMLSFRKDAPPAQYKVKSYKAAPD
FPETQRCYGEREFATSKLFDMQSVAELRFSGLETHVRRFAMEAAHLRHGCTHPLDLIGFF
CPALFAQHMIYDCGMVAAFTSQPQWQTLETEPLIDAPMSPIRALSARAVKCVHRWPRALL
ILGALVYVSVLVVWASANSDKTVDSLKASAAQAESAIPTKPLPSGGVTARRFQCVAWRAT
GKCRPNGPREPQNDKNCSNVISSGMSGYCEVEDIDTGERFQVMRRHCNSLKGNIRFRCSD
APAFANYRVEGHAAVQKALAPGFSLPHVADRGDAPQDGIVMVVYPKLLASAYATIRALRE
VLSCRLPIEIWFHVDEIGDDYASLAPLQQLAIVVGDVSFHPMYNPRAKSFLSKVFAIYNS
HFDRVLFLDADNVPVRDPAFLFESSQFETDGAVFWPDFWHPRRTLFNLHARSMLWELVDT
PYVDMFEQESGQLLVDRSRHAAPLELVYFYAFHAPNFFAKLEVVYGDKDLFRLAWMKLEA
PFHMIETVPAMAGRAINGSFCGMTMVQHDADGEVLFLHRNQHKLTGERDAKLEAAALKNT
AVPPEEALGAPQPDGFPDPVIWTHLLSFRKDASHKMYTIDAYRAAPEFPQWQPCYGRRYV
ENQRLFELQEFANLSFSGIETDIRRPSLG

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	1417	1649	1.1e-48	0.9924242424242424
GT71	194	428	2.5e-47	0.9924242424242424
GT71	800	1034	2.5e-47	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.22e-38	800	1034	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	2.87e-35	193	428	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
402574	Mannosyl_trans3	3.73e-34	1417	1649	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	2.40e-04	1466	1547	47	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133018	GT8_Glycogenin	0.002	281	316	90	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	1.48e-182	596	1760	50	1163
UIZ28119.1|GT71	1.60e-127	198	554	1	361
CCA25989.1|GT71	3.09e-96	698	1173	98	529
UIZ24000.1|GT71	5.25e-92	1309	1765	101	562
UIZ27901.1|GT71	5.37e-91	685	1063	59	433

PDB Hits     

PSURA_73619T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46982|MNN5_YEAST	4.92e-13	1417	1664	150	448	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	1.13e-12	1417	1649	150	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P38069|MNN2_YEAST	1.15e-12	1408	1649	162	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AD72|MNN24_CANAL	3.10e-12	1417	1625	293	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	4.63e-12	798	1034	172	449	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999959	0.000067

TMHMM  Annotations     

Start	End
12	34