CAZyme Information: PSURA_73614T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_73614T0-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652		72516.63	8.1977

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0004:346318-348276(-)

Full Sequence      

MDQKLLRPRAASQSPLLPRHEKVVAPPAARRRWRLWLLRLLLLAGALYVALLVCWSASRL
GSSHKVDNLVASVSEPEVGPTSDPSSSGTNAPPELLQPPPVGQVSAREVSIRAALAVARA
QEAELKAKMTPTDKREKKKVDARLRCRGWKATSDCNPDGSRLPELDLTCGKVVPVSQSGY
CELEDKDTGEVFHVLKRNCDSVTKDAKFRCLDAAEFVKFPIRANEVAKKALAPGFSLPHV
VPVVAGVNANQSGGRDGIVMVVYPRLLASAYATVRTLRHVLGCQLPIEIWYRPDEMRSTR
KGLAPLKKLAGSDTTGGISFHEINDARAFGYGTKVFAIYHSFFERVLFLDADNVPVRDPS
FLFQSPEFGETGAVFWPDFWHPGSTIFNIHRESLVWQLLGLPFADTFEQESGQLLIDRRR
HPAAMEVLSFYAFHRPNLFDAFKLAHGDKDLFRFAWMHQNASFHMIQSPPAVAGKVVDGS
FCGMTMVQHDAQGEVLFLHRNSHKLTGLPKREEANVRAQAFAKAREKLAAEKAKNGYGRM
TPKWSEVEAEIAAMEPAQTLEAPEADGYPDEIIWTHLLSFNSTAQRADYVIEAYNADPQF
PKDQHCYGQRHLGSNPNFYAQEIAGLSFAELETHLRRFAQEAAQQATQDARS

Enzyme Prediction     

No EC number prediction in PSURA_73614T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	256	490	5.4e-47	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.97e-34	256	490	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	9.50e-06	343	388	90	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	6.41e-123	260	644	1	356
UIZ24000.1|GT71	3.40e-96	146	639	106	564
CCA25989.1|GT71	1.02e-92	146	635	98	532
CCA25306.1|GT71	1.75e-91	144	521	69	462
UIZ27901.1|GT71	2.69e-88	132	521	58	435

PDB Hits     

PSURA_73614T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	1.19e-13	211	490	128	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	2.81e-10	254	490	148	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.81e-10	254	490	148	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5A687|MNN22_CANAL	1.13e-09	331	492	241	438	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|Q5AP90|MNN23_CANAL	4.60e-09	237	490	160	449	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000043

TMHMM  Annotations     

Start	End
35	57