CAZyme Information: PSURA_73539T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_73539T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	PramPr-102_SC0004|CGC11	58619.11	4.3361

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0004:98508-100215(-)

Full Sequence      

MSTSGRPSGVGRGSFSAGRSSEVERIIAAADVDTTFAGKKARYRGRRSTWPGALALLLLA
VVSVAGLTYYGIQTHDDVNETVASSEASDEAKYSDGVQVDDGSPTDPASDLTVTNPKSYT
DKGCEQPNYISKNGRIFAQLADGTSTQIDIKGINWKGMEDSKGVPKGLWDNTVDGDSLYR
YAYFLHYNKFNVVRFPLSIDAVMRNTDIDSNLINTNSNRALATASRYNTLLGLMVQGLGQ
FNIGVVLDFHVLSTSDDDSSGLWYGSSIKLADIKTAITTLAEAMCDSTHFNIIGIDLKDS
LSTDATWGDGSDTDWAVAATELANHMLTKCPKWLAFVQGVQGESHKDTYGDRSIKNTFLP
GSDLTGVSDAPIKLDTANKVVYAPKYYSSSYLPRLFFFEDGTTSGDLLDDYVEYSDEDLL
ANVKLNMNYSFGAAFDTGMAVVLSSFGGLVGDLDGTDKQTSTRIVKDVIAQMAGSTEPYL
AGGFWWTLNPDTTWPYPAPDDSNSTAQGVVDDTWRTANMDVLDLLANMSTTMSSVKFIPC
ST

Enzyme Prediction     

No EC number prediction in PSURA_73539T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	147	492	4.1e-130	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.76e-08	142	493	39	364	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25210.1|GH5_20	0.0	1	542	1	542
CCA23923.1|GH5_20	9.37e-184	2	540	4	535
CCD28218.1|GH5_20	3.42e-164	265	541	3	279
ABC87090.1|GH5_20	7.32e-106	19	540	112	627
ABK59037.1|GH5_20	7.32e-106	19	540	112	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	3.87e-22	139	520	12	342	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
1ECE_A	7.06e-22	139	518	12	340	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
4TUF_A	6.63e-17	139	528	8	343	Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_B Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_C Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913],4TUF_D Catalytic domain of the major endoglucanase from Xanthomonas campestris pv. campestris [Xanthomonas campestris pv. campestris str. ATCC 33913]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	1.68e-20	139	518	53	381	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	1.11e-19	139	535	45	388	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P19487|GUNA_XANCP	6.56e-16	128	528	25	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999781	0.000247

TMHMM  Annotations     

Start	End
50	72