CAZyme Information: PSURA_72942T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_72942T0-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712		78799.91	6.6954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0002:35806-37944(+)

Full Sequence      

MKLFLPTLVASVVLVLSGSADALNVKMPGVNYNSRKGPDWAPDSSKCKTASEVQKDMYAL
KGVTDKVRIYSLVDCNQAEVVLPAAKNAGLQVHLGIWTTNSHDYLLQEKAKLAGLIDKGL
YDNNVIGLHVGSETIYRKEITASTAISYMKEIRDYIRGRGKNTPVTIADVIDIYNANPQL
VDAVDYVSVNQFSFWERADVNEGAAITLDRLKNLRVLAANKGKKIVISETGWSSGGSDPS
AGVASPENQAKFFFDFFQMARSHNFDYYWYVAFDSKWRVTNGGKEVEADFGVFQEDDTMK
SNFQGLAIGWKDPRVLRNAGTKLMLSEDSGNVYMSVKSADWLVQEQQVWFFDSYTQQVRS
KSSDRCLDAYQGWNGGIVHVYRCIDDEANQKWTYDSSTGQLKHVKYQGFCLDQDAGQGNK
LQLYGCSPNNANQQWGAMDPNAISDGWTFSDGSVRFYTMESSKPFAQLVRNGGNVAIGFG
GSNVAGSQWVYDSNSHLMKAKDSNMCLDAYQPWDGGIVHVYACNANEANQRWTLDSNTNQ
LRHLTHSGFCLDADLAANNGAGKLQLWGCHLNNNNQVWRVVSASAIAATVYNSNANDAFL
QPTSQDTIVGARATGTSAQHWFWDANANHLTSKINAQCLDAYEAKEGGRVHTYACKATEG
NQKWNYDAANQMIKHATHTGFCLAFDNLTNKLLQLKSCNSGDNTQRIRIDTA

Enzyme Prediction     

EC	-	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	46	300	1.3e-21	0.9453376205787781
CBM13	483	590	5.4e-17	0.574468085106383
CBM13	315	441	2.7e-16	0.6861702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.06e-42	42	297	54	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.62e-20	397	578	1	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.01e-17	344	435	35	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.84e-16	546	706	9	125	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	6.49e-16	499	664	6	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18032.1|CBM13|GH17	4.05e-254	1	391	1	391
QBC18038.1|CBM13|GH17	4.05e-254	1	391	1	391
QBC18040.1|CBM13|GH17	4.05e-254	1	391	1	391
QBC18039.1|CBM13|GH17	4.05e-254	1	391	1	391
QBC18034.1|CBM13|GH17	4.05e-254	1	391	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.85e-32	37	300	39	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.96e-31	37	300	39	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	1.38e-28	47	300	40	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	2.29e-28	43	300	31	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	5.70e-28	43	300	31	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.70e-24	23	285	380	658	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	2.70e-24	23	285	380	658	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999715	CS pos: 22-23. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in PSURA_72942T0-p1.