CAZyme Information: PSURA_72937T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_72937T0-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		27139.10	4.2296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0002:2349-3954(+)

Full Sequence      

MAGIGITSSTATWKKLRGRVDVQQAVLWSIESWNALLPSVFSNCWKKTGLLDYYTCEYAE
PGVEDDIVNELAEMLTRLLHPSNPMSVEELLNPPDENILADEPTDEDFCRVESSERENGL
LLSEKDGGLYMSSKSSDWLVQEQQVWFFDSYTQQVRSKGSDRCLDAYQAWDGGIVHVYRC
IDNEANQKWTFESETGKLKHATHQGFCLDQDAGQGNKLQLYGCSPNNPNQQWSVIDPANI

Enzyme Prediction     

No EC number prediction in PSURA_72937T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	118	237	1.9e-18	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	4.09e-18	141	232	35	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	3.24e-13	154	234	4	84	Ricin-type beta-trefoil lectin domain.
238092	RICIN	6.03e-13	144	232	36	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	1.81e-12	160	235	9	83	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	4.26e-11	157	234	3	76	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18030.1|CBM13|GH17	2.25e-36	120	188	323	391
QBC18032.1|CBM13|GH17	2.25e-36	120	188	323	391
QBC18033.1|CBM13|GH17	2.25e-36	120	188	323	391
QBC18038.1|CBM13|GH17	2.25e-36	120	188	323	391
QBC18040.1|CBM13|GH17	2.25e-36	120	188	323	391

PDB Hits     

PSURA_72937T0-p1 has no PDB hit.

Swiss-Prot Hits     

PSURA_72937T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PSURA_72937T0-p1.