CAZyme Information: PSURA_72489T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_72489T0-p1
• CAZy Family: CBM9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38321.75	4.7278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC1569:580-1626(+)

Full Sequence      

MHSFALPLVALASLATSTAAAIDAPCNGPNARTQPPAGAIVVDITGTYNGSYQSVAEGMA
YLPNTTEEHTVFLFPGVYQEQVIVPKLAGPLVLQGYTCDSMSYAENKVTITHKMAQVNLA
PEIQNNRNELVSTMRFESSSGVKVYNLNIANPFEKIKKLGQAIAAYVDAENYGFYACNFT
GYQDTVCANKGRELFAKSYIAGMTDFIFGTEAKAWFESCDIETVGKGYITANGNANSSNL
SEYVFNRARVFGSSGNGSTYLGRPWRPYSRVVWQNSELSDVVHPEGWKRWNNESDTANLY
YKEFNNSGPGAIIDQRVSFSGQLNESVKITEILGESFESEWWVDTNYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	326	7.5e-71	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	7.02e-45	37	344	31	327	probable pectinesterase
178372	PLN02773	1.85e-43	34	342	1	305	pectinesterase
395871	Pectinesterase	6.88e-43	40	321	2	276	Pectinesterase.
178051	PLN02432	2.15e-42	39	325	10	274	putative pectinesterase
215173	PLN02304	4.09e-40	23	337	61	367	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54874.1|CE8	2.92e-197	1	348	1	348
ACO54870.1|CE8	3.28e-196	1	348	1	347
ACO54872.1|CE8|3.1.1.11	9.33e-187	1	348	1	348
ABQ63096.1|CE8	1.19e-172	1	348	1	344
ACO54873.1|CE8	3.94e-171	1	348	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.58e-56	32	347	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.45e-56	32	347	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	8.37e-32	40	321	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.95e-28	50	321	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.07e-68	32	348	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.14e-68	32	347	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.00e-63	32	347	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.00e-63	32	347	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	3.69e-61	1	347	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999766	CS pos: 21-22. Pr: 0.7731

TMHMM  Annotations     

There is no transmembrane helices in PSURA_72489T0-p1.