CAZyme Information: PSURA_72192T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_72192T0-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		37435.75	5.3867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0104:64990-66021(+)

Full Sequence      

MQTFALPLLALAGLAATVSTADVVCNGTDARTVPPTGAIVVDPTGAYNGSFHNISEAVAN
IPNTTDEHTLFFFPGVYHEQVLVSKLRGPLVLQGYTCNTTSYVDNQVTITQAKAQKDIPP
EITSGRNDLTSTLRLKTNKVKVYNLNVANTAGNVGQAVATIVEGSDYGFYACNLTSYQDT
LYANKGRELFAKSYISGAVDYVFGSKAQAWFESCDFETIGKGCITANGRTNETNPSYYVF
NKARVFGTSGNGTAYLGRPWRTFARVVWQNSEFSDIINPEGWQRWNNDNNTANVYFKEFN
NTGAGAALDKRVAFSGLLNASVPITEILGEGYESQWWVDTKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	48	316	2.7e-72	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	1.36e-44	39	321	34	309	probable pectinesterase
178051	PLN02432	4.01e-42	39	315	13	269	putative pectinesterase
215130	PLN02217	1.36e-40	39	317	252	527	probable pectinesterase/pectinesterase inhibitor
215173	PLN02304	1.05e-39	33	319	71	355	probable pectinesterase
395871	Pectinesterase	1.64e-39	39	317	2	277	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	3.08e-190	1	343	1	344
ACO54873.1|CE8	8.81e-190	1	343	1	344
ACO54869.1|CE8	1.53e-172	1	343	1	338
ACO54871.1|CE8	1.68e-167	1	342	1	343
ACO54872.1|CE8|3.1.1.11	4.16e-163	1	343	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.63e-58	29	342	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.30e-58	29	342	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.02e-33	32	316	4	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	5.04e-27	49	316	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.56e-77	31	342	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.46e-73	31	343	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.93e-65	9	342	8	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.93e-65	9	342	8	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.31e-64	31	342	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999771	CS pos: 20-21. Pr: 0.9483

TMHMM  Annotations     

There is no transmembrane helices in PSURA_72192T0-p1.