CAZyme Information: PSURA_72080T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_72080T0-p1
• CAZy Family: AA6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		26337.24	4.4879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0083:104115-104843(-)

Full Sequence      

MKLSLAAIALATAASTANAQEFCGRNDLKVVGDYTVYNNLWGEDNDPKGNQCTTVDSTTS
GSDIAWHTSFNWAGDNWQVKSYANAALKFDPVQISNVASIPTTMEYTYKYDGNIITNVAY
DLFTSATAGGDVQYELMVWLAALGGAWPLTSTGQPIKSVTLGGVAFNLYQGWNNKTKVFT
YVAKQTTNTFTADLRDFFTELPADNTIETTQYLTHVQAGTEPFQGQNATMTVTKYSAAVK
TN

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	239	4.5e-42	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	4.57e-42	32	239	1	206	Glycosyl hydrolase family 12.
235746	PRK06215	9.29e-12	32	219	50	211	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22033.1|GH12	2.94e-176	1	242	1	242
AAT66504.1|GH12	1.86e-140	1	241	1	240
EGZ11358.1|GH12	1.86e-140	1	241	1	240
ABB22034.1|GH12	8.95e-116	1	239	1	239
ABB22024.1|GH12	1.68e-115	6	240	7	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	2.82e-72	17	239	22	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VL8_A	4.16e-71	14	240	6	229	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	9.46e-71	21	240	6	222	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
5GM3_A	5.40e-45	21	240	2	219	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
6K9D_A	2.09e-44	20	239	1	217	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	1.11e-82	3	239	4	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	1.64e-79	1	239	1	237	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|Q4WJU8|XGEA_ASPFU	8.17e-75	1	239	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|Q0CRC9|XGEA_ASPTN	8.47e-75	1	239	1	249	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|B0XNQ1|XGEA_ASPFC	2.33e-74	1	239	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999720	CS pos: 19-20. Pr: 0.9703

TMHMM  Annotations     

There is no transmembrane helices in PSURA_72080T0-p1.