CAZyme Information: PSURA_71466T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_71466T0-p1
• CAZy Family: AA17|AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		71799.84	4.3264

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0021:202503-204485(+)

Full Sequence      

MIFGVDAAHGNSLLSDTVFFGHQINAAATFNPDIAYEQARITARDALAAGIPWVFDPVLD
IVHNPLWPRVYETFGEDPYLISTMGVAMVRGIQSYNESAACMKHWIGYSWSATGKDKDGA
EISDYDLMNSYFPPFKAAVDAGLLTGMENYISVNGAPVIENTKLMTTLLREDLGFDGLMV
SDYGEINQLTEFHRTARSTEEATKFALERTSLDMSMVGRNQAFTNATNKLIEESPEIIDR
LKQSVRRIVKTKLKLGLYDNPMPGAEYVDMVGSDDDVAAALTGARESIVLLQNNDSTLPL
LKNASVFLTGPSAHNIGYQCGGWSLQVWGVSGNDMFSHGVSVKQGFEVIAANDSFTYFNG
LNITGNYTDVDLATAKEYASQAEYTIAVIGEEPYEEKSGDIDDLSLPAGQIEYVKELAST
GTKVIVVLFEGRPRLLGGLPENVYAILNGMLACELGGQAVAEIAYGDVNPSGRMPITYPK
DSGNVMIPYRHRVTTQCATGDYCEPQWTFGHGLSYTDFTYSNMTISKSNVTSSSDSVNVS
VTVTNSGSMAGKETVMLFLTQPYRSISVPEVKQLKKFSKINLEVGASQIVTFELTAADWS
VYFPQIGSGLKLVAEDANYVVAIKPETDCDVYNETAAANPLCATFTLSTGEYPFGSLVAE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	202	1e-56	0.8796296296296297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	8.86e-105	1	623	106	750	beta-glucosidase BglX.
224389	BglX	8.61e-74	1	352	62	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.10e-51	1	248	68	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.28e-50	20	592	114	740	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.10e-43	288	515	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	1.48e-278	1	647	119	762
UIZ29613.1|GH3	6.47e-257	1	653	162	825
UIZ29432.1|GH3	3.39e-253	1	653	117	769
UIZ27116.1|GH3	2.46e-252	1	647	75	724
CCA27737.1|GH3	4.44e-238	1	647	156	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.98e-114	2	598	105	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	9.11e-83	1	623	86	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.75e-82	1	623	86	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	1.05e-81	6	606	79	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	5.49e-81	6	606	79	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	7.66e-126	1	623	171	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.16e-113	2	598	127	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	2.23e-82	6	630	72	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.41e-79	1	594	106	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.78e-79	1	594	106	725	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999637	0.000408

TMHMM  Annotations     

There is no transmembrane helices in PSURA_71466T0-p1.