CAZyme Information: PSURA_71328T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_71328T0-p1
• CAZy Family: AA17
• CAZyme Description: Predicted chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		26794.52	4.2549

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0013:447558-448343(+)

Full Sequence      

MKFAGVIASMGLIGSTPTVTPAATEATSSSASSGNSSFARFFDQDRFLTMFPDAIALYTF
DGLVNAANKYTEFANTGNDDNDKRELAAFLAQTAHESGSFQAAEEYARDTYTVWQYCDNT
TYSCAPGRRYHGRGPIQLSWNYNYYNAGEALGIDLLNNPDIVASDTEVTWMTALWYWMTP
HDGRVIHDVVAGVNGFAESTDIINGALECGPNAPNQVNEQQRIKYYTKMCEALGVQPLGD
TSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	40	243	6.9e-66	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	4.23e-74	42	243	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	1.42e-57	54	243	21	232	Chitinase class I.
225720	COG3179	5.42e-10	86	207	42	187	Predicted chitinase [General function prediction only].
381610	chitinase-like	0.002	122	179	19	75	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN31509.1|GH19	1.34e-139	1	245	1	234
CCD28125.1|GH19	1.44e-131	36	245	51	260
UIZ22871.1|GH19	1.56e-127	1	245	1	256
AIG55513.1|CBM1|GH19	1.82e-63	41	243	24	222
AVH63884.1|CBM50|GH19	3.61e-62	38	243	77	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WH1_A	2.08e-56	51	243	17	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	1.15e-55	51	243	16	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
2CJL_A	1.44e-53	46	243	7	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
7V92_A	6.99e-50	54	235	25	228	Chain A, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
1WVU_A	4.88e-49	34	243	58	265	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P86473|CHIT_ACTCC	1.84e-49	58	243	100	307	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|P36907|CHIX_PEA	1.93e-48	58	244	107	314	Endochitinase OS=Pisum sativum OX=3888 PE=2 SV=1
sp|Q41596|CHI1_THECC	5.55e-48	54	235	95	298	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P24626|CHI3_ORYSJ	1.07e-47	54	243	99	311	Chitinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht3 PE=2 SV=2
sp|Q39799|CHI1_GOSHI	3.32e-47	54	243	97	309	Endochitinase 1 OS=Gossypium hirsutum OX=3635 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.041126	0.958832	CS pos: 22-23. Pr: 0.9420

TMHMM  Annotations     

There is no transmembrane helices in PSURA_71328T0-p1.