CAZyme Information: PSURA_71121T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_71121T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	PramPr-102_SC0004|CGC9	54159.52	5.2342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0004:453573-455000(+)

Full Sequence      

MTKEIRFPDGFLWGAATASYQVEGAVNEGGRGASIWDAFSHTPGKTVNGDTGDVAIDHYH
RYKEDVQLMKSMGLKAYRFSIAWPRIIPAGVGQVNEEGVQFYNNLINELLANGIEPMATL
YHWDLPLALQTEFDGFLGEQIHDHFAQYARVCFEKFGDRVKNWITMNEPWVANYMGFGTG
MLAPGRKHNKHFEPYLAGHNMLLAHARAVEVYRKEFQETQGGQIGITLSAEWKEPGPTDD
PEQEKKNIAAAERAMAWSFGWFAEPVYYGDYPQIMKDRCGDRLPKFTEEQKKLLKGSSDF
FGLNNYSSNFVKPSPEFEAGIPPPNDNTGGLEADEGVTGYHDPSWVQTGAPWNYVTPWGL
KKLCAYIHEKYHPKNGIYITENGSAWPDVTKEEAQQDTQREDCYRQYIANVHEAITEGAD
VRGYFAWSFFDNYEWSMGYGIRFGMVWVDYKTQERVPKKSSYWYKQAIENNGFTV

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	472	1.3e-174	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	8	464	1	426	beta-galactosidase.
395176	Glyco_hydro_1	0.0	5	473	3	453	Glycosyl hydrolase family 1.
225343	BglB	7.93e-167	4	472	1	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	3.79e-136	7	464	28	476	beta-glucosidase
215455	PLN02849	1.19e-122	7	471	30	483	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23722.1|GH1	2.19e-247	1	474	1	474
QOD61968.1|GH1	1.31e-184	6	471	3	456
UOY08573.1|GH1	8.39e-183	6	472	3	457
QCX37656.1|GH1	1.19e-182	5	473	2	458
ARV14859.1|GH1	1.58e-181	6	471	5	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YJ7_A	6.91e-165	2	468	26	480	Chain A, Glycoside hydrolase [Nannochloris],5YJ7_B Chain B, Glycoside hydrolase [Nannochloris],5YJ7_C Chain C, Glycoside hydrolase [Nannochloris],5YJ7_D Chain D, Glycoside hydrolase [Nannochloris]
6Z1H_A	5.33e-160	3	472	7	449	Chain A, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
4GXP_A	3.65e-152	6	472	12	464	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
7F3A_A	3.73e-150	1	471	16	483	Chain A, Beta-glucosidase 42 [Arabidopsis thaliana]
3WQ4_A	6.62e-147	7	468	39	505	Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ4_B Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ5_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ5_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ6_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis],3WQ6_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5N863|BGL04_ORYSJ	1.47e-149	7	471	15	474	Beta-glucosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU4 PE=2 SV=1
sp|Q9FIW4|BGL42_ARATH	1.86e-149	1	471	15	482	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q25BW5|BGL1A_PHACH	7.14e-145	6	469	5	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	1.42e-144	6	470	32	504	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|B8AVF0|BGL12_ORYSI	2.44e-144	7	468	39	508	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSURA_71121T0-p1.