CAZyme Information: PSURA_53735T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_53735T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		41024.96	4.0572

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0083:155919-157019(+)

Full Sequence      

ASTHVQYSIRSGETTSKGVNLGSWLVAENWMTSSADFWTGAVNASQGEYTAIAEATDPDA
IRSHLEYHHSTFINESDIAEIAAVGINTVRVPIGYWIVGFDHNDPSGKAEWEVYTNGTLK
YLDALVTDWAKKYNVAVLLSIHAAKGSQNGADNSSPSVYGSELWGSFAENVNNTISMVEY
LAERYKDEEAFLGFGLLNEPNGDTTTDVLYDYYERAYSAIRETGSECVLTVAPLLSEQSP
TVLTDFMLAPAYTNVWVEWHPYFVWGYDDVSDADLVSTSVKVNFQGDVSQWNSVDGHNRL
FIGEWCFATNGKFEDDEDLFYEFAQAETAVVNQAGGGWTYWSWRIYEDETGDNMWSLRAV
LRDDKLK

Enzyme Prediction     

No EC number prediction in PSURA_53735T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	348	1.1e-46	0.9747292418772563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.19e-28	17	354	19	340	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.66e-12	63	343	15	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29069.1|GH5	3.94e-235	1	367	44	410
UIZ29004.1|GH5	2.24e-150	3	366	35	402
CCA17636.1|GH5	1.21e-122	3	363	125	491
AAM18484.1|GH5	1.78e-107	1	367	5	369
UIZ29723.1|GH5	5.00e-103	9	367	5	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3N9K_A	1.17e-28	17	344	15	365	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	2.86e-28	17	344	10	360	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	3.06e-28	17	344	15	365	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
4M80_A	3.06e-28	17	344	15	365	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
1CZ1_A	3.94e-28	17	344	10	360	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	4.43e-34	17	344	38	385	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	1.35e-32	17	365	43	358	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q12700|EXG_SCHOC	5.64e-32	18	344	44	392	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	7.70e-31	17	229	30	230	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|O93983|EXG2_WICAO	1.45e-30	17	308	43	320	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000030

TMHMM  Annotations     

There is no transmembrane helices in PSURA_53735T0-p1.