CAZyme Information: PSURA_52810T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_52810T0-p1
• CAZy Family: AA17
• CAZyme Description: Beta-glucosidase, lactase phlorizinhydrolase, and related proteins

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		50956.05	4.5727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0073:145691-147028(+)

Full Sequence      

PADFLFGSATASYQVEGAWSEDGRTPSIWDDFCREQPGFECANVADDFYHRYADDIKLMV
ETGLQSFRFSVSWSRVMNWDPETRRMQPNAPGLVFYHALLDKLVENGISPILTLYHWDLP
IELHNELTPQGWLNPDIIDHFVQYSTLLYNEFGGKVDFWTTFNEPLSFVVYGYNTGLHPP
GLHDSPTLVYEVAHKVLLSHAYAVQKFRELKSGGVIQPKARIGIVLNANQFYPLDASNPK
DVEATERAMNFEFGWWLLPLTTGDYPPVMRERVGDRLPRFTVEQAAVLKGSYDVFMLNHY
YSRAITDCDSETSNTPCSSLHVGFGQDKGVDDTHIVPGSRPGLQDSQGNNYCKSYTAFPP
GYLQTIKWMHAKDPSAEILLTENGWCGNDEVENLDQLWFFQSYTEQVYKAVVEEKIPVIG
YTAWSFLDNYEWGSYGPRFGLYYVNF

Enzyme Prediction     

EC	3.2.1.21:2	3.2.1.23:1	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	446	2.9e-129	0.9324009324009324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.19e-134	1	446	6	429	Glycosyl hydrolase family 1.
274539	BGL	4.65e-125	1	446	1	412	beta-galactosidase.
225343	BglB	2.26e-108	1	446	5	431	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	9.74e-90	1	446	31	460	beta-glucosidase
215435	PLN02814	1.39e-87	1	446	29	460	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ16993.1|GH1	6.56e-230	3	446	35	478
UIZ29641.1|GH1	9.31e-229	3	446	16	459
CCA20215.1|GH1	3.31e-200	1	445	24	467
UIZ29273.1|GH1	1.20e-145	48	441	5	385
NP_197843.2|GH1	9.20e-99	1	446	38	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	9.77e-92	1	446	12	427	Chain A, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1WCG_A	1.54e-88	1	446	6	439	Aphid myrosinase [Brevicoryne brassicae],1WCG_B Aphid myrosinase [Brevicoryne brassicae]
4GXP_A	1.31e-87	1	446	14	442	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
3WQ4_A	1.99e-87	1	446	40	486	Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ4_B Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ5_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ5_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ6_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis],3WQ6_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis]
4ATD_A	4.63e-87	1	446	23	492	Crystal structure of native Raucaffricine glucosidase [Rauvolfia serpentina],4ATD_B Crystal structure of native Raucaffricine glucosidase [Rauvolfia serpentina],4ATL_A Crystal structure of Raucaffricine glucosidase in complex with Glucose [Rauvolfia serpentina],4ATL_B Crystal structure of Raucaffricine glucosidase in complex with Glucose [Rauvolfia serpentina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FLU8|BGL32_ARATH	1.63e-99	1	446	38	490	Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2
sp|Q9FLU9|BGL31_ARATH	4.43e-96	1	446	38	490	Beta-glucosidase 31 OS=Arabidopsis thaliana OX=3702 GN=BGLU31 PE=2 SV=1
sp|Q4V3B3|BGL28_ARATH	4.21e-92	1	446	35	485	Beta-glucosidase 28 OS=Arabidopsis thaliana OX=3702 GN=BGLU28 PE=2 SV=1
sp|Q9M1C9|BGL30_ARATH	2.05e-91	1	446	32	483	Beta-glucosidase 30 OS=Arabidopsis thaliana OX=3702 GN=BGLU30 PE=2 SV=1
sp|Q9M1D1|BGL27_ARATH	2.17e-91	1	446	20	470	Beta-glucosidase 27 OS=Arabidopsis thaliana OX=3702 GN=BGLU27 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PSURA_52810T0-p1.