CAZyme Information: PSURA_50011T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_50011T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	PramPr-102_SC0005|CGC2	51871.58	5.1262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0005:107641-109245(-)

Full Sequence      

PAMHNEDQKQVVEMVQWAWKGYSTYAYSHDSLNVKTYKGTGLPDHDMALTLVDALDTLYL
VGMFDEFDRASEWVANNMEQRIFLSGFISFFETTIRLMGGLLSSYYLSGHVHLLTIANKL
GMALSPAFEVYEHGIPAKDFDIVTKRTRAAPSLAEVGTLQMEFKYLTRLTGYPKYQEQVD
RISDSVRSVTNMEEKYTNGLLPVQLNQQNGKITQSKITLGANGDSYYEYLLKQWLLSGKK
DDKFKTQYMTAVDGIIDKLLGKSKPNGLVFIGELVYGKFEPKMDHLVCFVPGMLALGYMN
GMPEEHLTLAKQLIETCYQMYAQMEAKLAPEIMYFNMKENVEEDLLVSATDAFNLLRPET
VESLMVLYRATKDEKYREYGRDIMKAFEKNCRLDRGGYASIGNVAKGPIHIGFRNEMESF
FIAETLKYLFLLFSDDSMLALDEVVFNTEAHPFPI

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	14	455	5.2e-133	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	3.38e-173	14	455	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.21e-164	5	455	70	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27321.1|GH47	8.96e-272	1	455	138	606
AIG56487.1|GH47	7.17e-154	4	455	71	506
BAC40402.1|GH47	2.02e-130	1	455	3	455
AAH06645.1|GH47	6.35e-129	1	455	113	565
AWP06495.1|GH47	2.74e-127	11	455	200	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FMI_A	1.03e-125	1	455	4	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.10e-125	1	455	4	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	2.41e-125	5	455	3	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1X9D_A	1.25e-124	1	455	82	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	1.51e-124	5	455	3	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2AJ15|MA1B1_MOUSE	1.54e-128	1	455	202	654	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	8.39e-128	1	455	201	653	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|Q9UKM7|MA1B1_HUMAN	6.51e-122	1	455	243	695	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q93Y37|MNS3_ARATH	9.24e-109	8	455	129	620	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	4.97e-95	11	455	201	644	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSURA_50011T0-p1.