CAZyme Information: PSURA_49663T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_49663T0-p1
• CAZy Family: AA17
• CAZyme Description: Glycosyl hydrolase, family 47

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	PramPr-102_SC0049|CGC1	49914.46	5.7046

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0049:225005-226345(+)

Full Sequence      

DERHALTKTVRDMFYHAYNGYLTHAFPQDDLLPLSCRGGEFELGRLPMLTLVDTLDTLAV
LEDATEFRRAVKLVVENADFDLDTEVSLFETTIRLLGGLLSAHLFAVNTDLKLFPEDDYD
GALLRLAIDLGDRLMPAFDTVTGIPYGTVNLKHGVPKGETPIASTAGAGSLSIEFTMLSV
LTGEPKYAAASRGAVRALYQRRSKIGLLGKHINTKTGDWTETSSGPGSNSDSFYEYLLKM
YELFGDRESLEMFAQVYPAVLEYNKHGDWYTDVSMYTGCHHHSGSSAVVFESLAAFWPGM
QIAAGDLNSAARSMNAFYRVWRDYGFLSEQFNVGDWKPVKSRGGGGARYPLRPELIESTF
YMHEATNDSSWLRAGAHVVHSLQKYAKTPCGYASIADVENKKQEDYMPSFFLSETCKYLY
LLFNTTHFFRKGSYVMTTEAHPLPILP

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	13	445	1e-135	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	9.26e-140	13	445	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.18e-87	8	447	74	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27914.1|GH47	2.65e-291	1	446	77	522
AIG55397.1|GH47	1.12e-212	1	446	161	613
AIG56334.1|GH47	8.17e-209	6	444	183	615
QCE07576.1|GH47	1.72e-140	1	447	30	470
BAT94804.1|GH47	9.45e-140	1	447	30	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	2.44e-57	8	445	7	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.79e-57	8	445	12	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	2.92e-57	8	445	12	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	1.40e-56	8	445	7	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	1.49e-56	8	445	90	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FG93|MNS4_ARATH	7.60e-136	1	447	35	475	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	6.42e-125	6	446	37	479	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	2.04e-124	10	443	39	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
sp|Q8BJT9|EDEM2_MOUSE	2.80e-124	10	443	39	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	1.56e-111	10	445	129	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSURA_49663T0-p1.