CAZyme Information: PSURA_45942T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_45942T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	PramPr-102_SC0026|CGC2	36093.04	4.5620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0026:187080-188108(-)

Full Sequence      

IAALAALSVSHAFVIGDAPGFAAGTTGGGTAEPVYPKTIEELTTLLGDAEPRVVVLDKGF
DFRGTEGTTTEQGCRPKSNADCLAKNNGFAGQDVILFEGDTTLTQTGGCDQAVPVDVTYD
NAAKKALVVKSNKTLRGIGQAGVLTGKGLWLDGDNIIIQNIHITELNPQYVWGGDAIYIQ
GTEDRAMKNVWLDHVKVSRVGRQMFVSGFAGVESLTISNSDFDGRTDWSSSCDGRHYWTF
IVDGTTTRVSLLNNYIHSTSGRSPKVVGASSESANVVAHIANNYWADNSGHSIEPGANAF
VLAEGNFIQDTAIPIQADDPAASSISTTDDCATALGRACSANV

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	117	309	6.3e-81	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.81e-36	116	306	1	184	Amb_all domain.
226384	PelB	2.36e-11	122	310	92	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	7.31e-08	120	306	23	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74068.1|PL1_4	9.26e-146	10	343	19	351
ADN18833.1|PL1_4	9.26e-146	6	343	15	351
ADN18834.1|PL1_4	1.75e-143	10	343	19	351
ACR19248.1|PL1_4	8.88e-138	33	343	133	442
AHX74069.1|PL1_4	3.24e-136	3	342	13	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	3.58e-82	14	342	3	314	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.01e-81	14	342	3	313	Pectin Lyase A [Aspergillus niger]
1IDJ_A	8.07e-81	14	342	3	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	1.20e-93	2	342	11	335	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	1.20e-93	2	342	11	335	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.08e-92	2	343	11	334	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	8.60e-91	14	342	24	336	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	8.60e-91	14	342	24	336	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000903	0.999062	CS pos: 12-13. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in PSURA_45942T0-p1.