CAZyme Information: PSURA_45108T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_45108T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		51319.71	4.6558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0023:63503-65238(+)

Full Sequence      

NFNEDQEKVVNMTRHAWHGYRKFAGWSDYLGMPNLEGGNVYGHDMALTTVDSLDTLFVMG
LHDEFDEASAWVKANLSETMFRESTVSYFEVTIRSLGGLLSAYYLSGEQHFLTLAHSLGK
ALQTAFTCGNYVPCRSVDLTVRHMFYEEPLLSEAGTFQLEFAYLAHATADDSFLLQVDHV
NSIVSEVTLTNVVREVSCTDPRCMSFESEDVRPVGALGDSHYEYLLKQWLLSGKKDDHMR
EMYVTAVAGMQAELVGRSYPSNYAFVGKRIATGELDPAMEHLTCFVPGMLALGYHHGMPT
SHLELAKELTETCAQMYLQSASHLSPEITQFATEASTQDSQENDGELYAHTTQDYNILRP
ETVESLMILHRVTGDDIYREHGRVIMEAFEKHSKVSQGGYRSTMNVWRGIPSTKEGPMES
FFVAETLKYLFLLFSDADILALDEIVFNTEAHPFPV

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	12	456	5.1e-115	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.40e-150	14	456	3	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.34e-134	2	456	64	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27321.1|GH47	8.99e-134	4	456	143	606
AIG56487.1|GH47	4.72e-114	6	456	75	506
BAC40402.1|GH47	2.31e-101	3	456	7	455
AAH06645.1|GH47	5.41e-100	3	456	117	565
AES01498.1|GH47	9.70e-100	3	456	53	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	7.24e-102	3	456	3	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	8.67e-102	3	456	8	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	9.20e-102	3	456	8	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	4.45e-101	3	456	3	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	8.79e-101	3	456	86	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2AJ15|MA1B1_MOUSE	9.82e-100	3	456	206	654	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	3.75e-99	3	456	205	653	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|Q9UKM7|MA1B1_HUMAN	2.90e-98	3	456	247	695	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q93Y37|MNS3_ARATH	1.95e-89	6	456	129	620	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|O60476|MA1A2_HUMAN	5.13e-81	4	456	179	626	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSURA_45108T0-p1.