CAZyme Information: PSURA_40336T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_40336T0-p1
• CAZy Family: AA16
• CAZyme Description: Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560		62516.68	7.1451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0118:102895-104647(+)

Full Sequence      

SSAASAEYDYVIVGGGSAGCVLANRLTEDPNNKVLLVETGPNDRTKWDSWKIHMPAALTY
NLANERYNWDYYTEPQKHLNGRRLPWPRGRVLGGSSSLNAMVYIRGHAYDYDDWQQSGAD
GWSYADCLPYFRKAQNHELGPDDYRGGDGPLHVIRGNQKEQILFKKFIDAGVQAGYPFTD
DMNGYQQEGFGWMDMTVWKGFRWSTASAYLRPAMKRPNLTVVTDTFVSKVVFEGKKAVGV
ETEDRKQKSTKQVRAAKEVILSGGAINSPQLLMLSGIGDAGHLKEVGVPVVQHVPAVGQN
MEDHLDLYIQYMCKKPITLHNATWKYPHKMAAIGLEWILRQTGMGASAHLESGGFIRSAP
GKRHPDLQYHFLPGSLTGQLTPGAYHAMQAHCSPMRAQSRGWLKLRSNNPHEHPIIEPNY
LSVEQDIVDMRAGVKLTREILEQQTMDEYRGDPISPSKDVQTDAQIDEWVRQNTESAYHP
SCTNRMGVDDNTVVDPLMRVHGVENLRVVDASIMPNIVSGNLNGPTIMIAEKAADIILGK
TPLPKSTAPVYQPKNWETSQ

Enzyme Prediction     

No EC number prediction in PSURA_40336T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	538	4e-172	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	0.0	1	543	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	0.0	4	560	2	554	choline dehydrogenase; Validated
366272	GMC_oxred_N	7.57e-66	80	306	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	9.31e-44	398	533	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.54e-25	1	513	49	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	0.0	2	560	22	580
CAB3230510.1|AA3_2	1.44e-242	2	560	19	578
ANI26486.1|AA3_2	1.62e-233	7	560	70	624
AWP09430.1|AA3_2	2.53e-232	7	553	19	566
CEF60566.1|AA3_2	3.19e-194	10	543	35	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.05e-92	1	548	1	571	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.47e-92	1	548	1	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.07e-92	1	548	1	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.22e-92	1	548	17	587	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	2.90e-92	1	548	1	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	5.86e-240	7	560	45	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.07e-236	7	560	40	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	6.18e-234	7	560	42	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	2.97e-195	8	560	5	553	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	1.88e-193	5	551	2	547	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PSURA_40336T0-p1.