CAZyme Information: PSURA_40276T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_40276T0-p1
• CAZy Family: AA16
• CAZyme Description: Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561	PramPr-102_SC0117|CGC1	61241.19	6.8857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0117:5802-7484(-)

Full Sequence      

EFDYVIVGGGSAGCVLANRLSADSSNSVLLVETGPKDRGLMDSIRLAMPALLPANLIDDR
YAWMYVTEPQRHLNGRRLSWPRGRVLGGSSSINAMIYNRGHALDYDGWQDAGADGWSYAD
CLPYFKKAQTHALGADDYRGGDGPLHVTRRLQRDQPLFQAFIDAAVQAGYPITDDMNGYQ
QEGVGWLDLTIQNGERCSASAAYLTASVLARENLTVLTDTFVNKVVFEGKKAVGVEVEPV
KAPSGQAPKQIRAVKEVILSSGAINSPQLLLLSGVGDAEHLKEIGVPLVHHLPAVGQNLE
DHLGVYLHVKCKKPVTLYNATTHFPHKMAWMGIKWLTSKTGPGTSPHIEAGGFVRSAPGK
RHPDLKWQFVLGASDENRQLLRDGHAMMLHCTPLRATSRGFIKLRSANPRESPIIEPNYL
ATEDDQVDLRNGVRLTQEVLKQQAFDDYRGDAVSPSGNVRSDAEIDAWVRQNASTDYHPA
STNRMGKDTDVNTVVDPQRRVHGLEGLRVVDASTMPTNVSGNLNAPTIMLAEKAADMILG
NPALPKSGVPVHESKNWETSQ

Enzyme Prediction     

No EC number prediction in PSURA_40276T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	539	2.3e-165	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	1	561	5	554	choline dehydrogenase; Validated
225186	BetA	6.77e-179	1	544	7	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	2.76e-58	74	303	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.50e-42	397	534	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.33e-33	2	539	56	577	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	1.87e-270	1	561	27	580
CAB3230510.1|AA3_2	9.29e-202	1	561	24	578
ANI26486.1|AA3_2	1.10e-201	1	561	70	624
AWP09430.1|AA3_2	4.16e-199	1	553	19	565
CEF60566.1|AA3_2	1.56e-163	4	544	35	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	2.47e-90	1	547	7	569	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.47e-90	1	547	7	569	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.47e-90	1	547	7	569	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.72e-90	1	547	23	585	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	4.88e-90	1	547	7	569	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NE62|CHDH_HUMAN	9.38e-206	1	561	40	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	1.28e-204	1	561	45	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	6.60e-204	1	561	42	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	1.75e-176	2	561	5	553	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	3.62e-171	1	560	2	547	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PSURA_40276T0-p1.