CAZyme Information: PSURA_40131T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_40131T0-p1
• CAZy Family: AA16
• CAZyme Description: Glycosyl hydrolase, family 47

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	PramPr-102_SC0114|CGC1	49969.24	7.7632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0114:99373-100710(-)

Full Sequence      

HMHVSERRHLQQQARDMFYHGYRNYMEHAFPWDELKPLSCSGRRWDRRERGDLDDVLGGF
SLTLVDSLDMLAVLGDTEEFARAVKLVISSVSFDRDVTVSVFESTIRVVGGLVSAHMLAS
PDHFGLMDEQEYRGVLLQLALDLGRRLLPAFDTPTGIPVHRVNLRRGVLPKDRAAKLTCP
AAAGSLLVEMSYLSRLSGDGRFEDRAKEAVEAIWERRSDIDLLGSAIDVGSGEWVHAHGG
IGAGLDSFFEYLLKYHLISGDSRWLTMFNASYQAVETHVNHDDVYLEVDMNGGKNQVRAR
RVSALQAFWPGLQVLAGDVSGAIRTHEHMFPLWDEFGAMPELLDLAPRGTSKPGNRGTVI
SWARTSPLRPDSLRVRITSTRLRRITNTSRWGVKCFRISVEFQKCLADTLLWAISIRLIL
KTAWIVTSCPKLRSICTCSSAMSLM

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	17	371	1.2e-98	0.7892376681614349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	4.24e-99	17	370	1	359	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.06e-53	6	339	71	381	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA23124.1|GH47	6.96e-164	3	371	23	380
AIG56058.1|GH47	1.11e-152	2	371	24	396
BAD52943.1|GH47	2.79e-100	5	371	43	384
CAY33089.1|GH47	2.79e-100	5	371	43	384
CAY09780.1|GH47	2.79e-100	5	371	43	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	4.10e-34	16	373	11	357	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	4.27e-34	16	373	11	357	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	4.46e-34	16	373	16	362	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	4.58e-34	16	373	16	362	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.13e-33	16	373	94	440	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q925U4|EDEM1_MOUSE	5.97e-96	14	341	129	469	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	1.33e-95	14	341	134	474	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q9FG93|MNS4_ARATH	7.66e-93	5	346	35	360	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q8BJT9|EDEM2_MOUSE	3.64e-88	9	371	34	372	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	1.46e-87	9	371	34	372	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PSURA_40131T0-p1.