CAZyme Information: PSK78600.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PSK78600.1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	PYGM01000015|CGC2	62470.23	4.0948

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11243	5595	N/A	158	5437

• Gene Location: location=PYGM01000015:84658-86319(+)

Full Sequence      

MLASAWDEVIDVKEIQQKNENLNLEAKNTNRFTSWHHAHSATFTKLQLWALDYDKVLYLD
CDTLPRAPSGAQVTDLLALELSPGAVAAAPEAAWPDTFNTGVMVLKPDKGVYGEMLNKLS
TLESYDGGDQGFLNGFFNPCPDWLANAIAQWTFSQPEVTPERAASTGAIPTNGRDARSSS
WVPIPYVYNAAAGASFRNYALDFYAAAAGSMADVRCIHYVGPHKPWHGSNNALDDEWWAA
WHEYSDSSPDELTREKSPDERDFTIRVLEVPSEEKPEPHSEPIFATKSASQWTEELALPK
DDHVPQQHHETTLTPADLCDPLKYIEEFGPTEETAAWDATREAPPLVTPDRSEDFELEMK
QFKSTWDQPDETFDEPQRVIDEEVHHAPLHRYDPIETTPLYQQIHDDLEPDFHDPPQREA
ASFGGDAAVVEEPINAAKDGLFGVYHSQVAERVFNDRSDYTPSHSLLLKEKLKEEQIMRA
IKAQDEEEDSDEEDDLNTDGNDEVEDEEEEFAQVEEGDSNHDENATTNIVPNLKPVFPWE
LRPDRVVERTFDF

Enzyme Prediction     

No EC number prediction in PSK78600.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	20	227	1.9e-28	0.6342412451361867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	7.89e-34	1	243	47	239	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	1.14e-12	34	228	72	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	4.33e-07	8	227	58	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	3.90e-06	52	227	95	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
224359	RfaJ	1.93e-05	15	254	54	277	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO20569.1|GT8	0.0	1	553	1	553
QWW23730.1|GT8	0.0	1	553	1	554
QRG37603.1|GT8	0.0	1	553	1	552
QWU87696.1|GT8	1.32e-86	1	552	50	565
QEL60839.1|GT8	3.75e-86	1	131	1	131

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3USR_A	2.08e-16	42	226	103	240	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCT_A	2.77e-16	42	226	103	240	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	2.81e-16	42	226	103	240	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
1LL2_A	4.72e-16	42	226	83	220	Crystal Structure of Rabbit Muscle Glycogenin Complexed with UDP-glucose and Manganese [Oryctolagus cuniculus],1LL3_A Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]
1LL0_A	5.03e-16	42	226	89	226	Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_B Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_C Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_D Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_E Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_F Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_G Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_H Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_I Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_J Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47011|GLG2_YEAST	2.98e-20	1	241	62	272	Glycogenin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLG2 PE=1 SV=1
sp|A6ZQJ2|GLG2_YEAS7	2.98e-20	1	241	62	272	Glycogenin-2 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=GLG2 PE=3 SV=1
sp|A7A018|GLG1_YEAS7	1.43e-17	8	328	74	364	Glycogenin-1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=GLG1 PE=2 SV=2
sp|P36143|GLG1_YEAST	1.90e-17	13	328	81	364	Glycogenin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLG1 PE=1 SV=4
sp|H2KYQ5|GYG1_CAEEL	9.24e-17	42	241	82	234	Glycogenin-1 OS=Caenorhabditis elegans OX=6239 GN=gyg-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSK78600.1.