CAZyme Information: PSK78362.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PSK78362.1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		48133.23	9.4019

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11243	5595	N/A	158	5437

• Gene Location: location=PYGM01000018:73434-74702(+)

Full Sequence      

MVALSTNKVIALGLLLRIGFFLFGIVQDKLSPVKYTDIDYVVFSDAAQYVASDKSPYMRE
TYRYTPLLAWILLPGTLGGLWEHYGKAVFILCDMLTGILMIKSLQREVIPDTRPSATFFQ
RNKLPILSAIWILNPMVITISTRGSSESVLSCLIMLAIENLMQGQLFMSAVWLGLSIHFK
IYPVIFLPAIMLHLVAKRPSLIRGLSNVPVIGWINSANMLYFVVTLVALALTNFTMYHFY
GYEFLYHSYIYHLTRLDHRHNFSLYNTALQAKAAKDYLINKPEGIDVISLVFGNIERIAF
VPQLLLSGIIIPVALARQNLMGCLFIQTLTFVTFNKVITSQYFIWYLVFLPGYLAKSKII
RTEYRLKGFIMIASWVLGQGLWLFYAYRLEFIGENTFNELLIASVIFFITNCWLIGEFIS
SA

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	140	419	2.2e-85	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.09e-74	3	419	5	415	GPI mannosyltransferase
252941	Mannosyl_trans	3.47e-69	140	419	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL61505.1|GT50	2.40e-293	1	422	1	422
QEO20435.1|GT50	1.14e-291	1	422	1	422
QRG39151.1|GT50	1.81e-288	1	422	1	422
QWW23894.1|GT50	1.78e-274	1	404	1	404
QWU88835.1|GT50	2.97e-158	4	379	3	377

PDB Hits     

PSK78362.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BHI9|GPI14_DEBHA	4.28e-141	1	419	1	407	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|Q5AMR5|GPI14_CANAL	4.28e-132	10	421	8	397	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|P47088|GPI14_YEAST	4.91e-100	12	420	11	387	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q6FXQ5|GPI14_CANGA	7.34e-92	1	419	1	393	GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	4.99e-90	4	420	8	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000000

TMHMM  Annotations     

Start	End
9	26
62	84
172	194
209	231
298	316
331	353
366	385
400	419