CAZyme Information: PSK76251.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PSK76251.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1442	PYGM01000072|CGC2	165286.33	5.6829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11243	5595	N/A	158	5437

• Gene Location: location=PYGM01000072:12695-17023(-)

Full Sequence      

MMLAHIWLCILVVSASSVSVKLHADWPEAPFALQLIEAVSSYNESLYAQAVRALYQRETE
ADDWDEDDEEGFEANQEDEGEQAALTDKSYYEAVTENLSPVAKGMVDLNLVNKIYTPRIV
AHYKHYEREVEPSLGSIEKQCAKDSFGNEITDPSASWVKYGNKIYCSDADLYALQLSKVS
EKTLEFDRVVGEASKKPLLVLYGAPESPRFQSMFETLYQFSSSDKLRFTWRYVPSEGYKD
RASIPGYGAVITPKQALNGTKKNSKVKYNGDLSKFLADVKKEGKPLRALDSDEYHDLSVK
ITALILEQPWSARYGLLEEILNNFPLYAPYLKLINNPVNFETVKSVAKSNEKKGASEDSV
GLYLNGASVHKLEMDLPHVVKKLKTEVDLIHKMNMLGFTTEQSKLLFSKYALMSAFKEVQ
YRSGDRENRYAIYKHEYDASDPSSGGLVYFNNIEKDDPYDLYDINRKEAYLGREASMLQF
GQVPPLKENAHELVFAIHFSSSIQVKVFFTFAKIILDRNLPQQVGVIPLVESDEDEKVAE
KFYHILSVSDAKEAFALLYQYYEAGTEAEKQAVLDKVEVSEESKGKFKNYKRTVREFSLD
APSVIVNGVIHDMKSPWQTAMTKQMGNDVRLLQQRIRNGDDTGKSLKAVLFQDSKDSRNS
RVSPKDLSNIRYKEISSNLLENSYSFKKINKPNDAPGTFWLIGDFNSKIILSQFAKLLDV
LETYEDKSLEIRVFSISEDNSLLINFFNKYGKAPLTDHSIEKLRAETLKAKSKVYTKISP
SQAKLLEQHQIQLHQAGMLFNSRYFKLTEVFEPKELIELIEFEQRRRLSIFKDLTDAYPD
IFRWKGIMHFKKSGYDDFAWFDLVSSVVARSFFLEDSQFQADVDRFDFSSLDFSNALNIT
DQNPMKFVDVLAFVNPFTDASQKIVSIVKSLKDLSFVNVQILMQPLEAVPESKSVDRFYS
SAFETSLPRFNDQGAFVGSCHAAGFDALVSSTKYSSELDTPSRWLHVKDSIGDLDHDEFE
PDSVHELNYTLDSLIVEGYAKDVKTAQSIATLTLEVTNGEAVFDAIVMHTLGYVQFQLKP
DVWNLEIQKGSKGRQIYNLLSASDNKYDTNDLPLEHTELGVFSLHGSVIHPRLQEKSEKE
IARAKKEVLVAKNADVNVFSLASGKLYERFLSTMMVSVKKHTKSTVKFWLLRNFLSAEFV
NRLPILADNYGFEYEFVSYKWPLWLRQQNEKFRQVWGYKILFLDVLFPNQLEKVIFVDAD
QIARADLQELVDTDLKGKVYGFPPMCDSREETEGYRFWKQGYWKNVLKNDLVYHISALFV
VDLKQFRMHYAGDRLRTHYQKLSSDKDSLANLDQDLPNNMQRSIPIHTLHQDWLWCETWC
SDETKDRAKMIDLCSDPFRKGGKLERVQRSIPEWVHYDAEIQRLQKNGLENGSTANVPHD
EL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1156	1404	4.6e-116	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	2.07e-175	1156	1424	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.26e-143	1156	1404	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	5.48e-49	1157	1397	2	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	8.05e-32	437	642	1	228	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	2.19e-31	30	237	3	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL60276.1|GT24	0.0	2	1442	1	1441
QWW23236.1|GT24	0.0	1	1442	1	1442
QRG38164.1|GT24	0.0	2	1442	1	1441
QEO20323.1|GT24	0.0	2	1442	1	1441
QWU89367.1|GT24	0.0	1	1442	1	1426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	9.87e-148	12	1430	5	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	9.87e-148	12	1430	5	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	9.38e-147	12	1430	5	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.40e-125	911	1430	659	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	2.58e-118	17	1366	3	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	7.75e-135	180	1421	150	1421	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	9.19e-120	86	1425	94	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.93e-118	86	1425	94	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	2.62e-118	86	1425	94	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU1|UGGG2_HUMAN	2.85e-117	12	1442	29	1516	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999709	CS pos: 17-18. Pr: 0.9058

TMHMM  Annotations     

There is no transmembrane helices in PSK76251.1.