CAZyme Information: PSK74709.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: PSK74709.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	PYGM01000194|CGC1	91518.54	5.1837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11243	5595	N/A	158	5437

• Gene Location: location=PYGM01000194:5270-7762(-)

Full Sequence      

MSFSEIDVEAVLEKLTVQEKIGLVSGLDSWHTFPVHRLGIPSLRISDGPNGVRGTKFFNS
VPTACIPTGTAMGSCWNADLMYKIGKLMGEQCRAKGAHVLMGPTINMVRSPLSGRSFESL
SEDPFLTGLLASSYCKGVHETKVMVCPKHLVCNDKEDFRMTMNVSITPRALREIYLMPFM
LVQKYADPEMYMTAYNRLNGKHCSENSHLLKGIVREEWSFDGCFVSDWYGVVSCADSINA
GLNLEMPGPSIWRGKLLEMSLFHDTVTEQSLDEAVKGVLYLVNKAAKSGIPENAHEGMKD
DTETTEMVLQAARESIVLMKNSNGVLPLKKSGKILIIGEAAKKANYACGGCTNVTPYRQI
SLYDALVAQLGDANVKFCLGASNRKSLPSFANFAKSKEELPIRFCVYDDPRSVIDRTPIT
DSYVGEIDAILGDFDPAKLRDPNQLYANFQVVINVPESGHYKFNLKVSGLAKVYVNGELK
IVNDLEHKTSGAFGLDAPEVFEEIIFEAGKDYLIEVDFASTIGKSSFITGYGCVSCGIEK
AVSPEESIKEAAAMAKEYDQVVVITGLNKDYECEGFDREDMNLPPYQDKLIESVLDSNPN
AVIIIESGTPATLPWIDRASALLHSGYLGEQLGNALVDVLFGEYNPSAKLPFTWPKRYED
CSSATSFQLDNGHSLTYHDDIYMGYRHMDVTMISPLFAFGHGLSYTTFEFKKLEVKDDED
FVKLKVDVENVGSASGEAVVQAYVAHRKCSVPTVVKSLKGFVKVQCDKGATTTASIVLDK
KLACSYYNTLLSKWTVEKGDYDILVGSASDKIELEGTFHVERTTHWVSLA

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	247	6.5e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.63e-60	37	345	57	368	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.89e-52	37	818	101	762	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	9.18e-47	524	705	57	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	8.55e-40	10	815	55	778	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.79e-31	37	281	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW25984.1|GH3	0.0	1	830	1	830
QEL63130.1|GH3	0.0	72	830	1	759
QWU87117.1|GH3	0.0	1	829	1	825
QWW24396.1|GH3	0.0	1	829	93	917
QRG38583.1|GH3	0.0	1	829	1	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.34e-201	4	829	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.71e-196	4	829	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.38e-139	6	823	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.03e-97	15	812	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.56e-92	8	820	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	4.58e-223	5	829	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.83e-222	5	829	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.03e-221	5	829	3	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.30e-220	5	829	3	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	4.41e-215	6	829	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000007

TMHMM  Annotations     

There is no transmembrane helices in PSK74709.1.