CAZyme Information: PSK40399.1

Basic Information

• Species: [Candida] pseudohaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] pseudohaemulonis
• CAZyme ID: PSK40399.1
• CAZy Family: GT22
• CAZyme Description: vanadate resistance protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1029	PYFQ01000001|CGC25	115970.05	5.1893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpseudohaemuloniiB12108	5285	N/A	151	5134

• Gene Location: location=PYFQ01000001:85467-88873(+)

Full Sequence      

MYTEEQRKKIDELVAQWLAVDPNELSRQEIQTLQEQQKYKELDGKLGKRIAFGTAGLRSS
MELGFAHMNDVTILQASQGLVSYLAKTENPSLVIGYDHRFHSQRYAEITASVALASGFTV
YYLGTAESLSDESDPDTKGGDKAYVHTPMVPFGIDFYKASAGVMVTASHNPAKDNGYKVY
YGNGCQIIPPHDAGIAKSIDENLEPWKDRGVWDVKGNFEKGLKEGKLVLVKEELSTKYVE
AVAEQLIQKSALSYEFVYTPMHGVGLEMFSRIFKKFHAKQTDVDVVPEQAFPDPKFPSVP
FPNPEEKGALDLAIARADAQGLSLVVANDPDADRFSVAIKRKNGKWQQLTGNEIGILFAA
YVIEERTSKADLGETWLLNSTVSSQLLRSLAEKTGCHFQDTLTGFKWIGNKAIDLKKAGK
LVPFGYEEAIGYMFSVVNDKDGISAAVMWLQLYEEWFGDGKQDPIEKLELIYQKYGWFKE
CNGYYKLDTLKTPGIFQAIRDSFPGDAPSTLGDFNVTEWRDLTIGYELSTPDHVPILPVD
PLSQMITAVLQPPHSSEQVRFTCRGSGTEPKLKVYIEGQSNGSEEAAQKLARACWDTLKK
HWFKPEENGLQEVVGFNPSIQEKAVLTEDYDLYKVTKDGVHKVEPEDASTTEEAEQIYKD
TVHIHDLNDYQGTTAGEAHNEVVLFLMPLRNAEHVLPMAFQNIMNLTYDHSLIDIAFLVS
DCSPGDTTLESVFKYSISLQNGTLADELLAAEQDKRNNLVRGTNDLYENYMDQAYMENVR
KAYNSPETWHKGYRTPFRSVSIYVKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTA
SALRAHHSWVYWRDVDIETCPGSVIQDLMKFDYDVMVPNIWRPLPGFLGNEQPYDLNSWV
ESEPALELAKKLDEDDVIVEGYAEYPTWRVHLAYLRDANGNPNEVLDLDGVGGVSILAKA
KIFRQGVHFPAFTFLNHAETEAFGKMAKKMGFRVGGLPHYTIWHIYEPSEDDLKKIAAME
REKRRKQST

Enzyme Prediction     

No EC number prediction in PSK40399.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	659	973	1.4e-121	0.9925373134328358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
240294	PTZ00150	0.0	9	610	4	578	phosphoglucomutase-2-like protein; Provisional
100092	PGM2	0.0	49	600	1	487	This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
397491	Anp1	8.69e-151	661	973	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
224034	ManB	4.38e-84	44	592	2	451	Phosphomannomutase [Carbohydrate transport and metabolism].
100093	PGM_like2	5.34e-49	50	590	1	453	This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWW21720.1|GT62	0.0	2	1025	7	1028
QOU21558.1|GT62	0.0	6	1025	3	1123
QWU88049.1|GT62	9.58e-302	615	1029	32	446
QEO21261.1|GT62	2.67e-278	610	1025	44	459
QRG37029.1|GT62	3.79e-278	610	1025	44	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.90e-48	665	1007	9	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]
1TUO_A	2.19e-12	50	580	12	447	Crystal structure of putative phosphomannomutase from Thermus Thermophilus HB8 [Thermus thermophilus]
1WQA_A	5.68e-10	88	600	40	452	Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii],1WQA_B Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii],1WQA_C Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii],1WQA_D Crystal Structure of Pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with Mg2+ [Pyrococcus horikoshii]
2Z0F_A	2.66e-09	50	577	24	500	Crystal structure of putative phosphoglucomutase from Thermus thermophilus HB8 [Thermus thermophilus HB8],2Z0F_B Crystal structure of putative phosphoglucomutase from Thermus thermophilus HB8 [Thermus thermophilus HB8]
5VG7_B	1.12e-08	53	501	20	446	Crystal Structure of the R503Q missense variant of human PGM1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00314|VAN1_CANAX	1.21e-217	621	1028	27	442	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|Q03262|PGM3_YEAST	3.41e-188	14	607	17	615	Phosphoribomutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRM15 PE=1 SV=1
sp|P23642|VAN1_YEAST	8.18e-178	633	1025	142	532	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|O74478|PGM3_SCHPO	8.81e-135	10	612	5	586	Probable phosphoribomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1840.05c PE=1 SV=1
sp|Q54UQ2|PGM2_DICDI	2.48e-119	9	611	4	598	Probable phosphoglucomutase-2 OS=Dictyostelium discoideum OX=44689 GN=pgmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000086	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSK40399.1.