CAZyme Information: PSK39837.1

Basic Information

• Species: [Candida] pseudohaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] pseudohaemulonis
• CAZyme ID: PSK39837.1
• CAZy Family: GT21
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1482		167209.81	7.6662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpseudohaemuloniiB12108	5285	N/A	151	5134

Full Sequence      

MGTSTVATTEEPLLTQNDTDGSEPKPLPRHPNETYEDYGKGLPKKLERRDEEHDIQNDDN
QIPQEDGKQSSHDNQSPAESNTGSTTPVDPSEGDEDSNKEYLNDLQFKKKDLKKPRTQSF
QLVLSTASLKSLRQTEPANPPALQRNSSNLGNMSLTGTGNHKNFQSFIQAPVLSSVSNLR
ALDNIVIGQQLPFDHKDPPSESELNRLRHNSNVTQSSTQPVIKDDRDDDDEYREETILQQ
QKLTLNALKKLSLSLAPIIRSDEETGPESRQLTTKLLNGLLKPESKLEQRKEEGNNKLQT
ENRTKPYQPAQVDLSLFASLTRQNKHLTEPQLPPSQGKPTNQPNERSKNAPLSSERDYHI
DMQRQMLSMQNQTNGSEPAQKLYGQTLLIEPDPVTDIKSAPQQTKGPINHSNLNLHSHKL
QQSQSQVLMNAPSQPLSHSQSLGQLQSQKSETELNPVVPPMDMNVRNRKTSQAEDTLPKH
ASLADKRIQQIKGFRNPMYIPAVLRKTLDKDADLGPLSSNLTDTGRESYFEGLSRVGLPN
RDHGSSSNSIRSVDLADNTIASPSLPFTGPYTLNKKQYEHILKAAPTRKHWLKDEAVSEC
GITTCRKNFNFFERRHHCRRCGGIFCKEHTLHYLYINHLAQFTTGGRGTLSRVCDNCIEE
YNEFMKQEFGVTCHRPRSSIDVTTAPLEEPEVKPSNKPALSPRKELLKYKNPHQRPRNQI
SPQVQIGKGYAREDQSTEQVAGSVPANWSVKIDTVRLLLRTVIFISIAGAAISSRLFSVI
RFESIIHEFDPWFNFRATKYLVSHSFYDFLNWFDDRTWYPLGRVTGGTLYPGLMVTSGVI
WHTLRDWFGLPVDIRNICVMLAPAFSGITAIFTYYFTKEMKDSNAGLLAAIFMGIAPGYI
SRSVAGSYDNEAIAITLLMATFYLWIKAMKVGSIFYGTLTALSYFYMVSAWGGYVFITNL
IPLHVFVLILMGRYNHRLYTAYTTWYALGTIASMQIPFVGFLPIRSNDHMAALGVFGLLQ
LVAFGAYVRSNVPTAQFKVFLTVSLFFTTLLGVAGLTALTAAGWIAPWTGRFYSLWDTNY
AKIHIPIIASVSEHQPTAWPAFFFDTNMLIWLFPAGVFFCFQEMRDEHLFIIIYGVLGSY
FAGVMVRLMLTLTPVVCVAAAIALSKLFDVYMDVSDIFGSEAAVEEVSEKKKKGPAKQGK
QFPIFKLLSKGVVLASFVYYLVFFVLHCTWVTSHAYSSPSVVLASRNPDGTQNIIDDYRE
AYYWLRMNTPEDAKVMAWWDYGYQIGGMADRTTLVDNNTWNNTHIATVGKAMATNEENAY
EILKKHDVDYVLVIFGGVLGYSGDDMNKFLWMVRISEGIWPDEIHERDYFSTRGEYKVDK
DASETMKNSMMYKMSYYRFAELFGGREAQDRARGQVIPSDPITLDTVEEAFTSQNWIVRI
YKVKDLDNLGREPKAAADFERGTSGANKRVRAVKKPALDLRV

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	757	1402	3.4e-192	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	0.0	758	1237	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	5.92e-151	756	1476	16	761	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
277299	FYVE_scVPS27p_like	1.21e-25	590	657	1	58	FYVE domain found in Saccharomyces cerevisiae vacuolar protein sorting-associated protein 27 (scVps27p) and similar proteins. scVps27p, also termed Golgi retention defective protein 11, is the putative yeast counterpart of the mammalian protein Hrs and is involved in endosome maturation. It is a mono-ubiquitin-binding protein that interacts with ubiquitinated cargoes, such as Hse1p, and is required for protein sorting into the multivesicular body. Vps27p forms a complex with Hse1p. The complex binds ubiquitin and mediates endosomal protein sorting. At the endosome, Vps27p and a trimeric protein complex, ESCRT-1, bind ubiquitin and are important for multivesicular body (MVB) sorting. Vps27p contains an N-terminal VHS (Vps27/Hrs/STAM) domain, a FYVE domain that binds PtdIns3P, followed by two ubiquitin-interacting motifs (UIMs), and a C-terminal clathrin-binding motif.
214499	FYVE	5.36e-22	590	662	3	67	Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PHD finger and the RING finger. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. The FYVE finger functions in the membrane recruitment of cytosolic proteins by binding to phosphatidylinositol 3-phosphate (PI3P), which is prominent on endosomes. The R+HHC+XCG motif is critical for PI3P binding.
396091	FYVE	2.19e-21	590	663	2	68	FYVE zinc finger. The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn++ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. We have included members which do not conserve these histidine residues but are clearly related.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU87245.1|GT66	QWU87245.1|GT66	0.0	1	1482	1	1497
QRG38406.1|GT66	QRG38406.1|GT66	0.0	750	1481	10	742
QEL60034.1|GT66	QEL60034.1|GT66	0.0	750	1481	10	742
QEO20766.1|GT66	QEO20766.1|GT66	0.0	750	1481	10	742
QWW23032.1|GT66	QWW23032.1|GT66	0.0	750	1472	10	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	6C26_A	0.0	758	1482	15	718	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	6S7T_A	2.32e-277	743	1459	63	791	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	6FTG_5	6.23e-267	758	1450	17	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	6S7O_A	6.94e-266	758	1450	17	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	6FTJ_5	6.26e-264	758	1445	17	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39007|STT3_YEAST	sp|P39007|STT3_YEAST	0.0	758	1482	15	718	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|O94335|STT3_SCHPO	sp|O94335|STT3_SCHPO	3.98e-312	756	1482	21	752	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|Q3TDQ1|STT3B_MOUSE	sp|Q3TDQ1|STT3B_MOUSE	2.71e-277	743	1454	60	783	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2
sp|E2RG47|STT3B_CANLF	sp|E2RG47|STT3B_CANLF	8.45e-277	743	1459	63	791	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	sp|Q8TCJ2|STT3B_HUMAN	1.19e-276	743	1459	63	791	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000004

TMHMM  Annotations     

Start	End
819	841
854	876
886	906
913	935
950	972
985	1004
1009	1031
1043	1065
1099	1121
1128	1150
1204	1226