CAZyme Information: PSK37681.1

Basic Information

• Species: [Candida] pseudohaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] pseudohaemulonis
• CAZyme ID: PSK37681.1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	PYFQ01000008|CGC2	48513.76	4.3829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpseudohaemuloniiB12108	5285	N/A	151	5134

• Gene Location: location=PYFQ01000008:429579-430853(+)

Full Sequence      

MRFSILTTISAALAVSIKRGGKASDWDFENNKIQGVNLGGWLLLEPYITPSLFEAFGDDI
PVDDYHYQKALGKEEAKKRLDHHYDTWYQEDDFRQMAEAGINTVRIPIGYWAYGLLPDDP
YIQGQDFYLERALGWARKYGINALIDLHGAPGSQNGGTSSGLRGSYDSIEDFLKSVGYQS
DENVSLTLTVLQKIFDKYGGEDYEDVVSGIGLLNEPLGFASDMDKLKDFYQWAYGNMRSV
SNNNVVISDAFQEEEGYWDNFMTLDQGFWKVVVDHHHYQWHTAEELNMTVEEHVQTACNL
GAQHKKEYHWNIVGEWSAAMTDCAPWLNGVGRGARWTGDYLNSPRIGSCEPYAKSSEWTE
EYKQKTRQFIEGQIDAFSSASGWFFWNWKCEDAVEWDMSELIRLGVFPQPFDDRQFPNQC
GVDF

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	391	6.3e-113	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.87e-67	32	421	17	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.81e-11	83	247	15	164	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWU88288.1|GH5_9	0.0	1	424	1	424
QWW24991.1|GH5_9	1.31e-251	3	423	4	429
QEO23771.1|GH5_9	3.07e-250	3	423	4	429
QRG39874.1|GH5_9	8.39e-248	3	423	4	429
QWU88320.1|GH5_9	3.00e-236	1	420	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.10e-168	20	421	1	397	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	3.26e-168	20	421	2	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	6.55e-168	20	421	2	398	Chain A, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	7.53e-168	26	421	2	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PBO_A	9.29e-168	20	421	2	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12700|EXG_SCHOC	3.85e-177	3	421	12	424	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q8NKF9|EXG_CANOL	8.43e-174	3	421	9	424	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|P29717|EXG1_CANAL	2.21e-167	15	421	34	436	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|O93983|EXG2_WICAO	7.61e-163	3	420	6	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12626|EXG_PICAN	2.04e-152	4	421	23	433	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.298260	0.701731	CS pos: 23-24. Pr: 0.2884

TMHMM  Annotations     

There is no transmembrane helices in PSK37681.1.