CAZyme Information: PSK34620.1

Basic Information

• Species: [Candida] pseudohaemulonis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] pseudohaemulonis
• CAZyme ID: PSK34620.1
• CAZy Family: AA6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	PYFQ01000020|CGC1	40234.92	5.3633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CpseudohaemuloniiB12108	5285	N/A	151	5134

• Gene Location: location=PYFQ01000020:51157-52320(-)

Full Sequence      

MRTFIVSTLLASAMAAPSGFHKHHHHQNEARAVVTTFRTVTVGGNGEVKGAIETSSASSD
SVTTSASTVTTSSSSSSSSSPSSSSASSASSSSSSSKTSSTASSSPSSGGSGGINGDLSL
FSDPTEKFEDGVHDCDSLPTGQGVIEVDWLSELKGGFTTIMNLNGDTSFTCKDGYYCSYA
CQAGMSKTQWPSEQPSNGISVGGLYCKNGKLYRSNKDKDYLCEWGYKGTNFVSKIDKDVA
ICRTDYPGSENMNIPTLLEAGKSAPVSVVDSDKYYMWKGGRSSTQYYVNNAGVSVEKGCI
WGTAGSGVGNWAPVVLGAGNTGGKTYLSLIPNPNNKDAPNYSIKIQGANGASTVGSCSYE
DGNYKGGHGSDGCTLTVDEGDAEFVFY

Enzyme Prediction     

No EC number prediction in PSK34620.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	81	387	1.5e-119	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.35e-133	130	374	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRG40034.1|GH132	1.28e-218	1	387	1	380
QWW25250.1|GH132	4.10e-218	1	387	1	383
QEL62477.1|GH132	8.27e-218	1	387	1	383
QWU89944.1|GH132	1.41e-217	1	387	1	388
QEO23609.1|GH132	4.43e-217	1	387	1	381

PDB Hits     

PSK34620.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AKU5|UTH1_CANAL	3.84e-157	114	387	103	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|P40472|SIM1_YEAST	3.63e-122	114	387	205	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|Q59NP5|SUN41_CANAL	1.94e-118	113	387	146	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	3.54e-118	128	387	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	3.54e-118	128	387	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000555	0.999422	CS pos: 31-32. Pr: 0.3060

TMHMM  Annotations     

There is no transmembrane helices in PSK34620.1.