CAZyme Information: PPTG_24766-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_24766-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		72151.21	5.7870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669770:8366-11328(+)

Full Sequence      

MSYSLFPPAPPSAPSTSAAPPPPVFRSTGGLQKLISPQFLSPDALLRPVPTNEWWGNLLA
WDGQRDSDAVFAGPYTYKVVQSQPGTIGSGLSVSYLVQYRSDGPINDNGAPRFYFYPPTI
KNWIFSAVELAEQSGAPPLTIQAWDDMGVHLSMAGMRMYLALGSAFTTVEYQDMQVQLGS
EHSIVAINGAPAREGHQVNGISFVISLNNGQQWVLYFFSNAGGNTSLVFEGNKLATTSKF
TGVVQAAFVSTSAVQSSVPQDDHKILQLYHASAGVYLRGATIQTFDSDSFVFNWQLASAA
GSNPGARFLHFALTHLQDMLDLSSVEAKDELVLYSHTHGPLFAYLLTTPPRSNPTWLCRV
PQAESQGVEACTAFYPPRAGCLTRDVVDRLNLCRVVSDEIYGDWSLPHEGSYYFKGKALQ
KFGTMCLVARQLADTTNPEMRDVAEHGISKLQQLLSQFVARQLADTTNPEMRDVAEHGIS
KLQQLLSQFADNQSAFPLVYDTVYKGIISSEALARNDMNVDFGNGVYNDHHYHYGYIVTA
AAMALYLDPNWRHSADAVKLRTVVDTLIRDVATSSPMGSDPYFPRYRYFNWWLGHSYSHG
VTPMADGKDEESTSEEVNFLYGIALYGQVTENAEQQALAKLILKVVQQRAQFLK

Enzyme Prediction     

No EC number prediction in PPTG_24766-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	37	462	2.2e-48	0.5546623794212219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	3.31e-72	48	645	89	620	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	3.10e-71	392	650	10	224	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.48e-35	36	345	4	299	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	0.0	15	645	15	614
CCA20578.1|GH81	4.74e-129	49	645	206	761
CCA20582.1|GH81	4.79e-129	49	645	206	761
CCA20580.1|GH81	5.74e-129	49	645	192	747
CCA20581.1|GH81	5.79e-129	49	645	192	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.41e-41	49	645	41	587	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.60e-41	49	645	66	612	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.95e-40	49	645	41	587	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.30e-12	528	632	414	513	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.32e-09	528	632	439	537	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.34e-51	46	646	32	568	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	6.16e-47	48	646	225	764	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.59e-45	29	645	62	603	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.80e-38	43	646	105	644	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.62e-32	47	646	459	1004	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PPTG_24766-t26_1-p1.