CAZyme Information: PPTG_22671-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_22671-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	KI669581|CGC1	57957.32	4.0900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669581:186286-188027(-)

Full Sequence      

MSDEFNLEGRSFEAGEYHLWTALDKNDGVNAALKIYATNMTTTECCDEDNCYFYIETDIA
ETNITVWNDYISPPGYEEVSFYYRSAMVQGWNKFCIQGELAVVRAQLPGAVSNVSGNPDV
ANLSMTARASSIDYYPMWPGTWMLGDLGRAIFTGSTARMWPFSYNECNETIFNSQNQRMN
AYTGAYLSNAENTDPECTESGGSTSTASTFTYQMDALSSNWGIHMAGYLDLVTYSVEWNA
AQMNPRKVMVEKPMYFIFNVAMSSSWGAKPPNAGTLGCYGDGIDAICDAFNMTTTECCDE
DNCYFYIETDIAETNITVWNDYISSPGYEEVSFYYRSAMVQGWNKFCIQGELAVVRAQLP
GAVSNVSGNPDVANLSMTARASSIDYYPMWPGTWMLGDLGRAIFTGSTARMWPFSYNECN
ETIFNSQNQRMNAYTGAYLSNAENTDPECTESGGSTSTASTFTYQMDALSSNWGIHMAGY
LDLVTYSVEWVPGDNEKSKASLSMRSPLTLSRIHHRMQLK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	3	177	3.2e-43	0.4049079754601227
GH16	304	444	6.4e-31	0.3558282208588957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185689	GH16_fungal_KRE6_glucanase	1.51e-25	2	268	4	274	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
397841	SKN1	3.10e-21	2	183	122	271	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
397841	SKN1	2.01e-16	334	435	181	271	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	4.06e-15	328	417	57	125	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	0.001	138	280	108	247	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27996.1|GH16	1.02e-110	1	495	63	467
UIZ24235.1|GH16_2	5.14e-76	1	292	62	554
UIZ28151.1|GH16	7.27e-76	1	495	63	476
CCA26187.1|GH16_2	4.14e-74	1	292	58	547
UIZ28149.1|GH16	2.05e-72	1	292	62	555

PDB Hits     

PPTG_22671-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33336|SKN1_YEAST	2.35e-15	1	175	382	514	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P32486|KRE6_YEAST	1.21e-14	1	175	330	462	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87023|KRE6_CANAX	3.78e-14	1	175	355	487	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P87024|SKN1_CANAX	6.60e-14	1	175	359	491	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|O13941|YEPB_SCHPO	2.38e-13	1	175	242	374	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PPTG_22671-t26_1-p1.