CAZyme Information: PPTG_19765-t26_8-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_19765-t26_8-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein, variant 6

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42402.48	8.3820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669742:20515-22215(-)

Full Sequence      

MGGEKRKVRVVLSTTTTAARQVIAERLKDNDDAVCVLAPLDHQQYVGRFYDAWQPDVGIW
IESEIWPTLITEAARRGIRIGLLNGRVSAISFRLWRLPGLHAFSKSIVGLFSLVLCQDEQ
NRRRFEHLGARNAHAALNLKFASPRLIGSENEISALRCAIGSRPAWVAASTHDGEEVMMA
QVHDDLLKCLRYDRQLLTVIIPRHPIRTSNIVKQIHRQFPELSVGLRSRDGLPTNAIDVF
IVDTMGETNLFYDTISTAVIGGSFVKRGGHNPIEPLRAGCHVFTGPHMDNFADIFQQLNQ
QSSVSEALRSVKDPQELVTALESRLKFLQDTSSDVSTPAPVDKRNQLTRTMADLAVSTLS
LHEQRLITWLASDAHPVNKP

Enzyme Prediction     

No EC number prediction in PPTG_19765-t26_8-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	6	142	1.5e-36	0.7570621468926554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	1.61e-92	8	326	80	387	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.30e-87	8	322	79	381	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	1.92e-41	8	142	43	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UEM05359.1|GT30	1.58e-66	10	360	81	419
AMW34117.1|GT30	3.50e-65	11	325	82	387
QQP87941.1|GT30	1.37e-64	10	360	81	419
UEM22691.1|GT30	1.93e-64	10	346	81	404
SNY92128.1|GT30	2.89e-64	9	349	84	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	2.90e-18	5	330	64	349	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	1.10e-11	162	346	41	217	Chain A, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4UND5|KDTA_RICFE	1.22e-40	8	321	125	423	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q9ZE58|KDTA_RICPR	1.15e-39	8	335	120	448	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1
sp|Q1RGU8|KDTA_RICBR	1.46e-39	7	322	77	377	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|P0AC75|KDTA_ECOLI	3.21e-39	12	324	78	391	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
sp|P0AC77|KDTA_ECO57	3.21e-39	12	324	78	391	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_19765-t26_8-p1.