CAZyme Information: PPTG_19765-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_19765-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		55595.89	9.0283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669742:20515-22648(-)

Full Sequence      

MNSIVGYCMTQSVSSSSTKRLSYAVMMVPLLAVYRGLWKAFMPMMSWYVRRKDLRRLVPS
TITAERFGRSEPPAHWCNGSGNAGFTVWIHGASVGECLSVLPLVDLALSHKLDETLAQSM
GGEKRKVRVVLSTTTTAARQVIAERLKDNDDAVCVLAPLDHQQYVGRFYDAWQPDVGIWI
ESEIWPTLITEAARRGIRIGLLNGRVSAISFRLWRLPGLHAFSKSIVGLFSLVLCQDEQN
RRRFEHLGARNAHAALNLKFASPRLIGSENEISALRCAIGSRPAWVAASTHDGEEVMMAQ
VHDDLLKCLRYDRQLLTVIIPRHPIRTSNIVKQIHRQFPELSVGLRSRDGLPTNAIDVFI
VDTMGETNLFYDTISTAVIGGSFVKRGGHNPIEPLRAGCHVFTGPHMDNFADIFQQLNQQ
SSVSEALRSVKDPQELVTALESRLKFLQDTSSDVSTPAPVDKRNQLTRTMADLAVSTLSL
HEQRLITWLASDAHPVNKP

Enzyme Prediction     

No EC number prediction in PPTG_19765-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	64	261	2.2e-43	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	1.29e-104	27	445	12	387	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.80e-100	18	441	1	381	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	1.59e-52	65	261	2	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UEM05359.1|GT30	1.57e-74	33	479	5	419
QQP87941.1|GT30	1.35e-72	33	479	5	419
AUG51867.1|GT30	2.00e-72	34	471	7	413
AJD50742.1|GT30	2.74e-72	34	441	7	381
AMW34117.1|GT30	3.74e-72	83	444	48	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	5.54e-21	87	449	43	349	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	1.73e-11	281	465	41	217	Chain A, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1RGU8|KDTA_RICBR	6.58e-45	85	441	49	377	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|Q4UND5|KDTA_RICFE	1.18e-44	87	440	98	423	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q9ZE58|KDTA_RICPR	5.69e-44	87	454	93	448	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1
sp|Q8VZA5|KDTA_ARATH	6.05e-44	33	454	10	415	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|P0AC75|KDTA_ECOLI	1.97e-42	87	443	51	391	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999952	0.000054

TMHMM  Annotations     

Start	End
21	38