CAZyme Information: PPTG_19132-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_19132-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	KI669663|CGC2	44545.33	5.0794

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669663:125580-126878(-)

Full Sequence      

MMIPSRGFTDEFYKALDLVYPYETSPPNPYFHAFPVSKNSPGDDAALVSGLRNNAADRDS
WSVEGYQHELDRLEGIKREANEETERLKRLIGAADKLISEEKDRLEDKRAASTLDIRTHQ
PRKIRNKLKCMGWRQTGQCNPFGKREPNSDHACNQIAQGGVSGYCEVLDEDTGELFRVMQ
LNCSSIRDHVVFSCAEAADFANFGLMAQGVYENALAQNTSDPSKLLGNNGNGNGIVMVVY
PKLLSSVFASISVLRSYNCTLPIELWISQPEVVRTPSMRPTLEMLQQRFSNVTVETIIDP
TIAGFSTKIHAVQHSKFENVLFLDADNVPVRDPTFLFETREFREHGAIFWPDFWHPEKTI
FNIQRESLLWELVDLPFVDIVGGADVLRVPSPQSL

Enzyme Prediction     

No EC number prediction in PPTG_19132-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	232	364	6.5e-35	0.5151515151515151

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.07e-20	235	355	4	133	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	8.81e-07	254	385	23	159	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27901.1|GT71	3.87e-58	107	379	46	317
CCA25306.1|GT71	5.29e-56	112	379	48	344
UIZ24059.1|GT71	1.36e-55	129	379	142	417
CCA25989.1|GT71	2.40e-54	129	379	97	360
UIZ24000.1|GT71	1.53e-52	128	379	104	389

PDB Hits     

PPTG_19132-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD72|MNN24_CANAL	1.48e-11	232	354	292	416	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q59KJ7|MNN21_CANAL	5.90e-11	233	354	246	378	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q59WF4|MNN2_CANAL	3.94e-09	248	354	202	312	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|P38069|MNN2_YEAST	1.22e-08	232	354	170	296	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	1.16e-07	234	368	151	291	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000092	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PPTG_19132-t26_1-p1.