CAZyme Information: PPTG_19031-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_19031-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		52073.43	6.9364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669662:85786-87245(-)

Full Sequence      

MGHDFQTTIIRVRRECWQGCLDTVKWKIQTLANEALNKALQPGFTLPNVGESTSDPRDGI
VMVIYPKLMASAFAAIRVLRDLGCKLPMEIWFVPREMRSHPADMKIFHELAADDMLSISF
REVTDFAATGFRVKVFSIYHSHFDRVLFLDADNVPVRDPTFLFELQEFQETGAVFWPDFW
HPTNSIFNIHSQSLIWELLDIPFANMFEQESGQLLVDRRRHGSRLELVRHYAFQRSDIFD
RMKLVHGDKDLFRLAWLKQLTPFHMIRHPPAMAGKVVNGSFCGMTMVQHDTEGNVLFLHR
NSNKLTGVTRNGDSANMAEAVRRVTAKLASKNPLGRQTPKFNEVQDELKLIEATLEKTQE
AEESDGFPDPVIWTHLLSFKNTSRRAKYVIETYNSISGFSKDQNCYGQHELGGNADFYMQ
KFEDLSFSGLETDLRRYAMEAADRRQQILKNP

Enzyme Prediction     

No EC number prediction in PPTG_19031-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	58	290	7.7e-51	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	3.97e-37	58	290	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	3.05e-05	142	188	89	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	2.36e-111	62	441	1	354
CCA25306.1|GT71	1.48e-78	59	307	202	448
UIZ28362.1|GT71	2.18e-77	46	307	767	1026
UIZ24000.1|GT71	2.97e-76	54	451	243	578
CCA25989.1|GT71	6.14e-75	53	306	209	461

PDB Hits     

PPTG_19031-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	3.80e-14	59	290	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	6.60e-14	44	292	137	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	8.77e-14	44	292	137	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q59KJ7|MNN21_CANAL	2.17e-12	44	292	229	528	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5AD72|MNN24_CANAL	9.29e-12	58	266	293	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PPTG_19031-t26_1-p1.