CAZyme Information: PPTG_18999-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_18999-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		44462.50	5.1131

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669658:86392-87794(+)

Full Sequence      

MQCLLVGLVLLAATTQCVSRSVSVYDAKGLFADRLTQEDRARLLKCPCSSASLCLPVDFA
GKKTRKEIFAFSVATDDRWKQYDWEQLTTVAWNEDKELLCHAHSKGVKIVVKHNFDDVNQ
LCNVSARQEWIKTTYNMIVENYADGVNIDTEKPMHGETSKCLASLVHELRHELEQHALTQ
NAQITFDVPWAPRGVDGRYYPWSELAAASDFLFVMSYDMRSQIYDACVAGANSPLALVKQ
GLQEFLFANDIAPSKLVLGVPWYGYRYPCLQEQQGAAAIDDASWCQIRPVPFFGAPCSDA
AGGQIDYGDIRRLVKSHGLLEQWDPTTLTPFVWYSPPEGGRYQIWFDNPRSLKAKYALVC
ELGLRGVGMWNADTLDYTAVNDSQTMWSSLAEALQP

Enzyme Prediction     

EC	3.2.1.-:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	58	374	2.4e-40	0.8445945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119354	GH18_chitobiase	1.84e-115	45	390	18	358	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
214753	Glyco_18	4.34e-33	123	374	88	333	Glyco_18 domain.
119353	GH18_CFLE_spore_hydrolase	3.27e-26	68	370	31	300	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
395573	Glyco_hydro_18	6.44e-25	68	373	27	305	Glycosyl hydrolases family 18.
226376	YaaH	6.42e-16	121	370	186	405	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27644.1|GH18	2.85e-212	5	393	426	836
CCA16750.1|GH18	3.77e-133	39	389	28	380
CCA27450.1|GH18	8.04e-133	43	389	3	351
AIG55971.1|GH18	2.55e-115	21	394	2	385
AAA40924.1|GH18|3.2.1.-	5.82e-88	33	394	19	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.37e-13	121	370	90	306	Chain A, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
6JM7_A	1.65e-13	127	377	102	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
4WIW_A	3.10e-13	90	376	53	333	Chain A, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
6JM8_A	1.69e-12	127	377	102	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
5WUS_A	4.94e-12	123	377	92	344	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01460|DIAC_RAT	1.03e-88	33	394	19	367	Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
sp|Q8R242|DIAC_MOUSE	5.06e-86	46	394	25	366	Di-N-acetylchitobiase OS=Mus musculus OX=10090 GN=Ctbs PE=1 SV=2
sp|Q01459|DIAC_HUMAN	8.96e-83	46	394	41	382	Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
sp|Q8T293|DIAC2_DICDI	6.53e-66	46	391	26	371	Probable di-N-acetylchitobiase 2 OS=Dictyostelium discoideum OX=44689 GN=ctbs2 PE=3 SV=1
sp|Q7KWW8|DIAC1_DICDI	5.13e-57	45	390	22	366	Probable di-N-acetylchitobiase 1 OS=Dictyostelium discoideum OX=44689 GN=ctbs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999668	CS pos: 19-20. Pr: 0.8856

TMHMM  Annotations     

There is no transmembrane helices in PPTG_18999-t26_1-p1.