CAZyme Information: PPTG_18908-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_18908-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	KI669649|CGC2	44220.89	6.8147

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669649:120586-121818(-)

Full Sequence      

MNRLQLVFVAALALVARSTTAVTIGSATGLATGTTGGGDVSPVYPTTIKELVAYLRDSKP
QVVVLNKTFDFRTLEGNTTAEGCRPDYMRKCVALNNGFKSQDVIVQDGDMKNTGGCTGGV
SVNVTYDNAPFNRLNVRGNKTIRGIGKNGVIMGKGLALNGDNIIVQNIHITEINPHLVWG
GDAITIQGLTDGTVPLKHIWLDHIKISRIGRQFIAVDKAGAATMTISNSDFDGHTEFSKT
CDGHHYWSFLFYGKHTGISMINNYIHYLSGRLPKVGGTPDTNAVVHIANNFYKDNSYHSM
EIGTNGYVLAEGNYFVNTTKPLYDGDDPDVPGMVDGSIYAPLKSSEDECNAQLGRLCEAN
VLEESGPFGSRNGTIALAEIKPHPTIARHKPQQAQQLQLSASNFGVGELE

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	317	3e-80	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.20e-34	122	318	2	189	Amb_all domain.
226384	PelB	3.18e-14	139	332	102	290	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	8.46e-12	135	315	31	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19246.1|PL1_4	2.17e-267	1	410	1	410
AHX74066.1|PL1_4	8.82e-267	1	410	1	410
AHX74068.1|PL1_4	1.56e-171	7	409	7	399
ADN18834.1|PL1_4	1.56e-171	7	409	7	399
ADN18833.1|PL1_4	1.06e-164	1	409	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.35e-74	24	391	4	344	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.31e-73	25	381	5	333	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.85e-73	25	381	5	333	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	4.43e-08	120	317	52	248	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFS2|PELA_ASPCL	2.55e-84	18	368	15	340	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	8.96e-82	8	370	6	342	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.01e-80	25	375	26	351	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.01e-80	25	375	26	351	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.03e-80	3	368	2	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999759	CS pos: 21-22. Pr: 0.9331

TMHMM  Annotations     

There is no transmembrane helices in PPTG_18908-t26_1-p1.