CAZyme Information: PPTG_18624-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_18624-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		84018.77	5.9940

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669647:145285-147507(+)

Full Sequence      

MSPSSSSFAPSYSCMIEGSGRDEVEALKRTALLDDKLNHDAASNEEKTLLLPKDQHEDDR
STQKRRDAAGVLGREVILRYVRWAMEILVVMIIVAGSLRLLSTKTCDHEVRRTPSFSLHR
SGGKLMHGGHRLRSFLRHMKSHPPVLGELPSDADITLGVDVELERAMDIYCHGPLLHAVQ
MANVFSDSKYFVDMPIKENSSAFDILVDFQRRELAMTDYRPHAHDTHEQLLRRFINDHFD
PPGTDLLPITPFDYQGQYHPPMVSDIQDNELRDWAFGLHQIWQTLGRIRNPNVKGSLLRS
RKLDAPSLNQPANVLIVPGGRFRESYYWDSYWIVQGLLVSDMPITARGIVNHLLEYVSDY
GFVPNGGRIYYLTRSQPPMLSDMVKLVARLPADGNESEYDEEYLRAALPILEREYDFWMQ
HGPCGHAVELTRRNSSAGAIDKATYVLNRYTSNANRPRPESYREDVLVAAEIFDRTMQMD
GNAAATERHKDKYYNNVIAAAESGWDFSSRWLRDPLDMKSMVTSSVVPVDLNAIMYRVER
NLMEFNRHLGNDDRAQYFEGAAARRLEAIDAILWSEKHKSWKDYDLETDTHSSIISVSDY
TPLWAKAFNSSDIDRLKHVVTSLKSSGLLQVGGVQTTTIFSGQQWDSPNAWPPEQDIIVE
GLLAVNTTESYSLARELSQTWTQTSLTAWKQTGLMFEKYNSSEIGGLGAGGEYFPQFGFG
WTNGVILKFLTIHQNLLLAE

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	185	731	7.4e-161	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	0.0	170	730	13	541	alpha,alpha-trehalase
395961	Trehalase	6.24e-161	185	733	3	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
237326	treA	1.10e-94	173	730	49	533	alpha,alpha-trehalase TreA.
224541	TreA	1.08e-93	169	731	55	550	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.74e-88	175	733	52	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20368.1|GH37	0.0	1	740	1	749
CCA17719.1|GH37	2.06e-249	159	737	117	705
CCA18365.1|GH37	2.06e-249	159	737	117	705
CCA21422.1|GH37	1.01e-241	159	738	155	745
AOW41677.1|GH37	1.31e-226	160	737	41	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	5.78e-113	187	730	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	8.80e-112	187	730	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	2.48e-84	173	730	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	2.53e-82	173	732	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	7.69e-78	173	732	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8J4S9|TREA_APIME	7.72e-127	168	740	44	575	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	1.72e-118	169	730	53	582	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|O43280|TREA_HUMAN	4.89e-118	168	737	31	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	7.88e-118	155	737	9	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|Q9W2M2|TREA_DROME	1.67e-115	154	733	34	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_18624-t26_1-p1.