CAZyme Information: PPTG_18612-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_18612-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		71556.98	5.8663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669647:121967-123883(-)

Full Sequence      

MRIGMISHNGSCRGFLPLLLVLFWSITSSLALGRRYIRPVPDPITPELMPAETASHAGDN
TRQQQILQLQRVYCRGELLHEVQMQELFPDSKHFVDMPIKATSSVDEVLVQFQELKVTFA
NKTTGTEWKTQLAAFIDQHFDPPGAELVPVTPPDYKEGEIPQKIKEIRDEPLRGWAMELH
KLWKVLARVPASESADQASRSSFLHSLPIDTPSDVLARQFNGENVLVVPGGRFRESYYWD
SYWIVQGLLVSGLHQTARGVVNHLLEYVAEFGFVPNGGRIYYLTRSQPPMLSDMVRLVAK
LEDANDTSAWDLQYLRAAVPILEREYDFWMHRGVHGHAVEVPGFSSQSAGEAFVLNRYVA
HADEPRPESYREDVNTASLVFANQSDTEDKNSLYNEIIAGAESGWDFSSRWFGDYSTMAT
IRTSRVIPVDLNAILHRVELNLAKFHELLGNYVASTRFRNAAKTRVRAMAAVLWSESDGC
WKDYLLDSRLHSPVISLSNYSPLWGGAFDGSDSSRLERIVASLERSGLVEEGGLQTTTSV
TGQQWDAPNAWPPLQDIIIEGLQTAGTATSRALAKRLVLTWVKAGLVAWQKTGLMFEKYN
AQQLGGVGDGGEYTPQFGFGWSNGVILTFLTKYQEQLR

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	87	633	3.9e-159	0.9979633401221996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	0.0	72	633	12	544	alpha,alpha-trehalase
395961	Trehalase	5.34e-169	86	633	1	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.37e-105	73	638	56	557	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.09e-93	11	633	7	536	alpha,alpha-trehalase TreA.
237326	treA	1.59e-90	76	630	49	533	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20373.1|GH37	0.0	37	624	3	595
AOW41677.1|GH37	3.78e-230	68	637	46	613
UIZ20368.1|GH37	1.45e-209	72	637	177	746
CCA17719.1|GH37	6.74e-208	67	637	122	705
CCA18365.1|GH37	6.74e-208	67	637	122	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.99e-108	89	633	39	554	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.60e-107	89	633	39	554	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	5.37e-82	76	632	52	538	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	3.65e-75	76	630	15	499	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.57e-70	76	630	15	499	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JLT2|TREA_MOUSE	1.44e-136	71	637	28	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|P19813|TREA_RABIT	4.73e-132	71	637	31	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	8.45e-128	72	637	32	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q8MMG9|TREA_PIMHY	2.80e-126	72	633	49	571	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|P32359|TREA_TENMO	1.22e-122	71	633	28	552	Trehalase OS=Tenebrio molitor OX=7067 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007339	0.992609	CS pos: 31-32. Pr: 0.9514

TMHMM  Annotations     

Start	End
13	32