CAZyme Information: PPTG_18550-t26_11-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_18550-t26_11-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein, variant 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		38781.74	7.6662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669654:28460-29725(-)

Full Sequence      

MFTILPFEEDIFNAGEEIQSPDNKGRTWCHFVGHPAVEDFLEINGVYESGATKSLDCTLD
SDIETGADGLLSFSKYERSNLLARGRLLQDLAAIGREPSARTRVRENFGISKDAFVICAL
VGSRVNEVKKSLQLVLEAIAKFKEAKSQQQQIFVVFPTISAVEQQVKNHINTAAPEVKWR
VLTDLATEERFRLFQVTSGSDCASLYTFLKLIALTPVDLQSSDAAVAVSGTIVLETTLAN
LPTVVIYRANRLTEWIAKRLAAVRFVSIPNILLGRPLIPELLFSDCAAPKIAETLRVLLH
QKTKEKDALQLTRALSTLTKWQETTENKLKPIRASDLVAKRILNVLTDK

Enzyme Prediction     

No EC number prediction in PPTG_18550-t26_11-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	313	2.3e-41	0.596045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
234580	lpxB	1.23e-31	1	346	138	375	lipid-A-disaccharide synthase; Reviewed
223834	LpxB	1.77e-29	70	306	143	350	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
397004	LpxB	9.69e-23	70	315	140	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
167141	lpxB	1.36e-08	219	332	486	603	lipid-A-disaccharide synthase; Reviewed
237606	PRK14089	1.82e-06	215	282	229	300	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBN03888.1|GT19	4.91e-21	105	349	23	251
SQI36376.1|GT19	1.43e-17	71	312	146	357
BBK37326.1|GT19	6.61e-17	1	318	145	366
QIY08475.1|GT19	8.96e-17	12	304	109	357
AVQ88268.1|GT19	4.08e-16	12	304	109	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.46e-13	71	299	147	345	Lipid A Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.46e-13	71	299	147	345	Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1D393|LPXB_MYXXD	2.32e-16	98	296	173	338	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
sp|B6IST7|LPXB_RHOCS	3.51e-16	95	349	172	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
sp|F4IF99|LPXB_ARATH	6.50e-15	110	309	242	414	Probable lipid-A-disaccharide synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPXB PE=2 SV=1
sp|Q5PD72|LPXB_SALPA	1.55e-14	71	299	147	345	Lipid-A-disaccharide synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=lpxB PE=3 SV=1
sp|B5BAN9|LPXB_SALPK	1.55e-14	71	299	147	345	Lipid-A-disaccharide synthase OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PPTG_18550-t26_11-p1.