CAZyme Information: PPTG_18414-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_18414-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
979		109650.05	5.4922

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669646:11342-14556(+)

Full Sequence      

MRGESCLRYHVGSTWWHYEWCFDRHVRQFHPFPKGENSEEKSIMLGVFDPQKPQPLRVLA
VDNLARLTDPDRMGYMAQQRYSAGDFCEARGARRSVKLQVKCCALHDNETYVDSVDEKAP
CDYEMNVCSPVACGLMQRDQFVLTAPTYMKEDERKALTKTVREMFYHAYNGYLTHAFPQD
DLLPVSCKGGEFELGRLPMLTLIDTLDTLALLEDATEFRRAVGLVVENADFDLDTEVSVF
ETTIRMLGGLLSAHLFAVNTDLKLFPEGGYDGSLLRLAVDLGDRLMPAFDTVTGIPYGTV
NLKHGVPKGETPIASTAGAGSLSVEFTMLSVLTGEPKYAAASRGAVRALFQRRSKLGLLG
KHINTKTGEWTETSSGPGSNSDSFYEYLMKMYELFGDREALEMFAQVYPAVLVHNKHGDW
YTDVSMYTGCHHHSGSSAIIFESLASFWPGMQVAAGDLKVAAESMNSFYRVWRDYGFLSE
QFNVGDWKPVKSRGGGGARYPLRPELIESTFYMHEATNDSSWLRAGAHVIHSLQKYTKTS
CGYASIADVESKKQEDDMPSFFLSETCKYLYLLFNTTHFFRQGNYVMTTEAHPLPILPTK
LVEPVLQASSASNDVVYDNRYSPHRVMQCEVPKFYDFIDYSVHYEGKVVAPDTDAMSAIE
KIAQAASENAKPTTNEKKKSIDTESVASNVLQEWLPALEEKLRKIGGKNIDDKWLEKLLE
ENSLKSKQPTTDQNSQGQVVQYLYGGNQLGEFRVEQLPGRIEQGDDYHPPYLSWNYVYKI
NEDFTLPMDQRCSLRVQVGYTSYPGELQHSAKGSPHDKGKPNVWLTVPCVGAGFGVTSTF
QASRAFPASELVLADPIDACSEVTNLSEENVRGKTLIVLRGECFFEKKARNAAKWGAAGV
IVVNTEDDDLVMVMGGMEENSEQDTDEPLGIPVVMVPQRLGEWFEARLAESKASSLSPVK
VSVELTKKTKRNSWRRLVP

Enzyme Prediction     

EC	3.2.1.113:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	164	596	2.4e-134	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.42e-139	164	596	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.94e-83	148	599	63	521	glycoside hydrolase family 47 protein; Provisional
239047	PA_GO-like	3.77e-18	835	965	21	139	PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10. This group contains various PA domain-containing proteins similar to the functionally uncharacterized Arabidopsis GRO10. The PA domain may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
240122	PA_subtilisin_1	4.90e-17	830	957	1	117	PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1. A subgroup of PA domain-containing subtilisin-like proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following subtilisin-like proteases: i) melon cucumisin, ii) Arabidopsis thaliana Ara12, iii) Alnus glutinosa ag12, iv) members of the tomato P69 family, and v) tomato LeSBT2. However, these proteins belong to other subtilisin-like subgroups. Relatively little is known about proteins in this subgroup.
238300	PA	7.79e-16	828	952	1	120	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27914.1|GH47	0.0	76	966	1	967
AIG56334.1|GH47	6.13e-249	1	936	43	878
AIG55397.1|GH47	8.58e-246	6	936	33	870
QCE07576.1|GH47	9.12e-130	152	598	30	470
BAT94804.1|GH47	1.24e-129	152	598	30	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	5.16e-54	152	594	8	433	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KIJ_A	1.27e-52	159	596	7	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.45e-52	159	596	12	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.52e-52	159	596	12	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KKB_A	1.85e-52	161	597	26	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FG93|MNS4_ARATH	7.84e-126	149	624	32	519	Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	3.80e-119	133	597	13	479	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|Q9BV94|EDEM2_HUMAN	1.04e-114	161	594	39	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
sp|Q8BJT9|EDEM2_MOUSE	1.42e-114	161	594	39	480	ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	4.72e-101	154	596	122	581	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PPTG_18414-t26_1-p1.