CAZyme Information: PPTG_17668-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_17668-t26_1-p1
• CAZy Family: GT49
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	KI669633|CGC1	25010.70	5.5671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669633:101476-102232(-)

Full Sequence      

MKFAGVIASMGFLGMASAGSGEVVQSPTQQSTPCTTPPAVTPAATVPSSSGAGSSSFARF
FDQERFHEMFPDAVELYNFDGLVNAANKYTTFANTGNDTNDKRELAAFLAQTAHESDNFK
AAEEYARNTYTVWQYCDNTTYPCAPGRRYHGRGPIQLSWNYNYYNAGNALGIDLLNNPDI
VANDTAVTWMTALWYWMTPQGGRVIHDVVAGVNGFAESTRIINARCARH

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	59	226	4.6e-55	0.8225108225108225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	4.92e-61	61	223	1	187	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	2.12e-46	77	223	25	195	Chitinase class I.
225720	COG3179	3.01e-08	63	228	6	196	Predicted chitinase [General function prediction only].
381610	chitinase-like	6.81e-04	107	198	1	75	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22871.1|GH19	1.44e-114	1	223	1	215
CCD28125.1|GH19	2.83e-113	1	223	1	219
AAN31509.1|GH19	4.99e-110	49	223	19	193
BAY91283.1|CBM50|GH19	2.60e-50	55	223	157	323
ABX04815.1|CBM12|GH19	9.75e-49	54	223	227	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	1.15e-45	63	223	5	167	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	1.75e-42	66	223	13	165	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
7V92_A	2.59e-42	77	223	29	199	Chain A, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V91_A	1.02e-41	77	223	29	199	Chain A, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
4IJ4_A	1.35e-41	66	223	12	164	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q41596|CHI1_THECC	1.76e-40	50	223	65	269	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P86473|CHIT_ACTCC	7.02e-40	77	223	100	270	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|Q39785|CHI2_GOSHI	1.89e-38	77	220	79	234	Endochitinase 2 (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=2
sp|P21226|CHI2_PEA	2.21e-38	77	228	95	271	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
sp|Q39799|CHI1_GOSHI	2.21e-38	77	223	101	272	Endochitinase 1 OS=Gossypium hirsutum OX=3635 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001061	0.998881	CS pos: 18-19. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in PPTG_17668-t26_1-p1.