CAZyme Information: PPTG_17667-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_17667-t26_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		30398.70	4.4887

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669633:94621-95451(-)

Full Sequence      

MKSQAFPWSSHSHLLPFELRCDPHFRSLLQASKQPPSVYQSKSTMKLAGVIASMGLLGVA
SADDSSSSFARFFDQARFQEMFPDAVELYNFDGLVDAASKYTEFANTGNDDNDKRELAAF
LAQTAHECDSFKAAEEYARDTYSVWQYCDNASIACAPGQRYHGRGPIQLSWNYNYYNAGE
ALGIDLLNSPDIVSTDTTVTWMTALWYWMTPHAGRVIHDVVAGENGFAQSTDIINGGLEC
GPDAPNTGNEQQRITYFTKMCEALGVEPLGATSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	70	274	1.9e-63	0.974025974025974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	1.56e-72	73	274	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	2.11e-52	89	274	25	232	Chitinase class I.
225720	COG3179	7.76e-12	75	238	6	187	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN31509.1|GH19	9.32e-155	45	276	1	234
CCD28125.1|GH19	2.40e-131	56	276	40	260
UIZ22871.1|GH19	7.78e-129	45	276	1	256
AVH63884.1|CBM50|GH19	1.19e-57	69	274	77	276
AIG55513.1|CBM1|GH19	1.28e-57	51	275	5	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WH1_A	7.38e-54	68	268	3	200	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	4.05e-53	68	268	2	199	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
2CJL_A	3.53e-51	75	274	5	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
7F88_A	3.24e-47	68	268	9	191	Chain A, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]
1WVU_A	3.52e-45	75	274	66	265	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P86473|CHIT_ACTCC	1.29e-45	89	266	100	299	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|Q41596|CHI1_THECC	3.51e-45	89	266	99	298	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P36907|CHIX_PEA	1.34e-44	89	275	107	314	Endochitinase OS=Pisum sativum OX=3888 PE=2 SV=1
sp|P36361|CHI5_PHAVU	3.14e-44	89	266	102	300	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|P06215|CHIT_PHAVU	3.22e-44	89	266	103	301	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996775	0.003230

TMHMM  Annotations     

There is no transmembrane helices in PPTG_17667-t26_1-p1.