CAZyme Information: PPTG_17201-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_17201-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		31362.22	6.3718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669627:233885-234748(+)

Full Sequence      

MVALQNLAVFAVASTLAVGADARKLSSGVCYAPWHHSNVNWDVLAGDMAQVSQHFSSIRT
YQAQFNGVNAISIAAAAGLHIAVGVQLTDPRWIDSEIQAVCDGYAKNSWAVEAVYVGNED
LKNGNFGTYTADQIAGYIRRVKSCVGNTPVGSAQRINEWLGADSAWALANACDVIGVNIH
PFFTPGSQSALKKLEAQWDQMISKFGAAKVRLTETGWPYAGESYAGNVPSKGAMTQFFYD
YIYGWCPSKSQSYWFMMYDTTVSYTGAEYEKHWGLFGTDKSQHINMP

Enzyme Prediction     

No EC number prediction in PPTG_17201-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	283	4.7e-18	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.99e-24	3	280	17	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	1.48e-162	1	287	1	288
UIZ21797.1|GH17	9.39e-96	20	287	566	834
UIZ21931.1|GH17	2.33e-93	1	287	1	288
UIZ21795.1|GH17	1.00e-68	1	200	1	202
CCA18992.1|GH17	2.97e-40	28	287	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.51e-10	28	281	39	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	9.14e-10	28	281	39	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBG6|BTGE_NEOFI	1.21e-12	52	236	324	508	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	4.11e-12	28	229	348	553	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	4.11e-12	28	229	348	553	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	2.09e-11	50	263	52	287	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q04951|SCW10_YEAST	5.84e-11	26	279	136	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999762	CS pos: 22-23. Pr: 0.9157

TMHMM  Annotations     

There is no transmembrane helices in PPTG_17201-t26_1-p1.