CAZyme Information: PPTG_17187-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_17187-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		48688.39	4.0261

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669627:159933-161309(-)

Full Sequence      

MVCATYKTVFAMMAALAISSADATGSCYAPWHHPTVNEDVLLKDVQKIGQFFSSFRTFET
IMSGVNIIDVAAKAGVKVSPGVQMNDLTKVDSEIQAVCDGYAKNPGSVETIWVGNENLQN
GDFGTVSADQLVGYIQKVKECTGGNVAVGTAQRINEWNTAAGADKVSAACDKYGVNIYPF
FTQGEQTPIQKLEAQWKQMTSKYEEGKIQLTETGWPTEGETSFGNSPSLETMQQYLNDFV
QWSSGKGESYWFMMFDTTTSYTGAEYEKHFGCFDKDGNPKVSIPGGFKDGSTTTSPTQGS
QTQGSQTQGSSTGSQTQQGTDAPATPATDAPAATPAANDGGDQTQQQGEVLVTPAPTEQQ
YAVDVPEYRTEAPGTPPANDGGDQTQQQGEVPGTPAPTEPQYAVDIPEYRTEAPTNPTGE
IPAQETPVQGTPSVDVPTQDTPSVTPAPVVQSGKDCAM

Enzyme Prediction     

No EC number prediction in PPTG_17187-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	44	282	2.7e-19	0.9228295819935691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.73e-13	17	276	39	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.01e-06	208	283	229	307	Glycosyl hydrolases family 17.
237015	PRK11901	8.65e-05	290	452	55	240	hypothetical protein; Reviewed
411384	Streccoc_I_II	0.006	362	454	821	928	antigen I/II family LPXTG-anchored adhesin. Members of the antigen I/II family are adhesins with a glucan-binding domain, two types of repetitive regions, an isopeptide bond-forming domain associated with shear resistance, and a C-terminal LPXTG motif for anchoring to the cell wall. They occur in oral Streptococci, and tend to be major cell surface adhesins. Members of this family include SspA and SspB from Streptococcus gordonii, antigen I/II from S. mutans, etc.
223021	PHA03247	0.009	353	452	2719	2849	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	2.08e-103	9	284	9	288
UIZ21797.1|GH17	1.80e-92	25	286	574	836
UIZ21931.1|GH17	3.23e-67	23	284	27	288
CCA18992.1|GH17	5.42e-53	23	284	20	282
UIZ21795.1|GH17	1.12e-42	23	196	27	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.47e-06	34	283	50	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

PPTG_17187-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999744	CS pos: 23-24. Pr: 0.9588

TMHMM  Annotations     

There is no transmembrane helices in PPTG_17187-t26_1-p1.