CAZyme Information: PPTG_17186-t26_1-p1

Basic Information

• Species: Phytophthora parasitica
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora parasitica
• CAZyme ID: PPTG_17186-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		43678.03	3.9142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PparasiticaINRA-310	23240	761204	119	23121

• Gene Location: location=KI669627:157805-159058(-)

Full Sequence      

MVFSSIRVAVAMATLAVAADATGVCYAPWHHTSVDDTVVGADMTEIAQYFSSVRTYQAQF
SGVNAIQAAAAAGLKVAVGVQLTDASAIDAEIDAVCQGYASNPDAIEAVYVGNENLKNGD
FGTFTADELVIYINQLKTCVGNTPVGSVQRINEWLTADGASTLAAASDVVGVNIYPFFTV
SDQTAVEKLEAQWTQMTSMYDSSKLHLTETGWPSSGENYQSNAPSIETMQQFLNDYVTWS
KSVGSSYWFMMYDTTVSYTGAEYEKHFGLFTSDGTQKVTIPGSDSTTLQTTSTSSSGLDS
TAQDTTDAPVTSTTAPVTSDFSIITPTTTSAAIDTPTTTAPVATDATTTAPSTAIDTAAE
ATSLNTDAPTTAPTTAITETYAPSLEGSTQSEAEAAPAATTVVPTSGKCKVSLRKRY

Enzyme Prediction     

No EC number prediction in PPTG_17186-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	277	2e-24	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.90e-19	16	273	40	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.53e-06	141	277	147	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	3.92e-109	22	281	28	288
UIZ21797.1|GH17	3.54e-103	23	299	574	852
UIZ21931.1|GH17	1.89e-71	5	281	6	288
UIZ21795.1|GH17	1.42e-50	5	193	6	200
CCA18992.1|GH17	1.87e-46	21	281	20	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.13e-09	42	277	58	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.23e-08	42	277	58	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04951|SCW10_YEAST	7.30e-10	18	273	133	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q5AUT0|EGLC_EMENI	1.59e-09	106	257	120	287	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	6.72e-08	32	280	34	303	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P15703|BGL2_YEAST	9.24e-08	42	280	49	308	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P53189|SCW11_YEAST	2.18e-07	39	235	301	508	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999767	CS pos: 21-22. Pr: 0.8372

TMHMM  Annotations     

There is no transmembrane helices in PPTG_17186-t26_1-p1.